PLCE1 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-122-319	100 μL

Catalog No. 89-122-319 Supplier Abnova Corporation Supplier No. PAB20821

Description

Rabbit polyclonal antibody raised against recombinant PLCE1.

This gene encodes a phospholipase enzyme that catalyzes the hydrolysis of phosphatidylinositol-4,5-bisphosphate to generate two second messengers: inositol 1,4,5-triphosphate (IP3) and diacylglycerol (DAG). These second messengers subsequently regulate various processes affecting cell growth, differentiation, and gene expression. This enzyme is regulated by small monomeric GTPases of the Ras and Rho families and by heterotrimeric G proteins. In addition to its phospholipase C catalytic activity, this enzyme has an N-terminal domain with guanine nucleotide exchange (GEF) activity. Mutations in this gene cause early-onset nephrotic syndrome; characterized by proteinuria, edema, and diffuse mesangial sclerosis or focal and segmental glomerulosclerosis. Alternative splicing results in multiple transcript variants encoding distinct isoforms

Sequence: NSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCNRSLETDEEDSPSEGNSSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAFDHGTELIPWYVLSIQADVHQFLLQGATVIHYDQD

Specifications

• Antigen: PLCE1
• Applications: Immunofluorescence, Immunohistochemistry
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: phospholipase C, epsilon 1
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: PLCE1
• Gene Alias: FLJ23659, KIAA1516, MGC167842, NPHS3, PLCE
• Gene Symbols: PLCE1
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human PLCE1.
• Purification Method: Affinity Purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 51196
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only