Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ RAGE Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578736

Catalog No. PIPA578736


Only null left
Add to Cart

Description

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Lung Tissue, RH35 whole cell, HELA whole cell. IHC: mouse lung tissue, rat lung tissue, human intestinal cancer tissue.

The Receptor for Advanced Glycation End-products (RAGE) is a gene located on human chromosome 6p21.3, encoding a transmembrane receptor belonging to the immunoglobulin superfamily. RAGE is expressed in various tissues, with significant levels in the lungs, and plays a crucial role in cellular signaling and inflammation. As a receptor, RAGE binds multiple ligands, including advanced glycation end-products (AGEs), amyloid-β peptide, high mobility group box 1 (HMGB1), and S100/calgranulin proteins, facilitating diverse pathological processes like inflammation, cancer progression, and neurodegeneration. The interaction between RAGE and its ligands triggers intracellular signaling pathways such as NF-?B activation, leading to inflammatory responses and oxidative stress. In the context of chronic diseases like diabetes, Alzheimer's, and cardiovascular diseases, RAGE is a critical mediator, linking metabolic disturbance to cellular dysfunction. Therapeutic targeting of RAGE signaling is under investigation, aiming to mitigate its contribution to inflammatory and degenerative diseases.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

RAGE
Polyclonal
Unconjugated
AGER
advanced glycation end product receptor; advanced glycation end-product receptor; advanced glycation end-products receptor; advanced glycosylation end product-specific receptor; advanced glycosylation end product-specific receptor variant 2; advanced glycosylation end product-specific receptor variant 3; advanced glycosylation end product-specific receptor variant 4; advanced glycosylation end product-specific receptor variant 5; advanced glycosylation end-product specific receptor; Ager; MAPK/MAK/MRK overlapping kinase; MOK; MOK protein kinase; RAGE; RAGE isoform NtRAGE-delta; RAGE isoform sRAGE-delta; RAGE/AGER; RAGE1; RAGE-1; RAGE-4 ORF3; receptor for advanced glycation endproducts; receptor for advanced glycation end-products variant 20; receptor for advanced glycosylation end products; receptor of advanced glycosylation end products of proteins; immunoglobulin superfamily; MHC class II; MHC class III; renal cell carcinoma antigen; renal tumor antigen 1; SCARJ1; sRAGE; STK30
Rabbit
Antigen affinity chromatography
RUO
11596, 177, 81722
-20°C
Lyophilized
Immunohistochemistry (Paraffin), Western Blot
500 μg/mL
PBS with 5 mg BSA and 0.05 mg sodium azide
Q15109, Q62151, Q63495
AGER
A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI).
100 μg
Primary
Human, Mouse, Rat
Antibody
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.