Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Abnova™ Rat Ccl2 Recombinant Protein
Used for Func, SDS-PAGE
Supplier: Abnova™ P4848
Description
Sequence: QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTENSpecifications
P14844 | |
Lyophilized | |
14.1kDa | |
Escherichia coli expression system | |
10 ug | |
Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. | |
<0.1 EU/μg | |
Ccl2 | |
The activity is determined by the ability of MCP-1 to chemoattract THP-1 cells and is detectable starting at 10ng/mL. | |
Recombinant | |
Escherichia coli expression system |
Functional Study, SDS-PAGE | |
24770 | |
Ccl2 (Rat) Recombinant Protein | |
1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue | |
QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN | |
RUO | |
MCP-1/Scya2/Sigje | |
Ccl2 | |
E. coli | |
None | |
Lyophilized |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction