Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Rat Ccl2 Recombinant Protein

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P4848

Catalog No. 89-938-380


Add to cart

Description

Description

Sequence: QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN
Specifications

Specifications

Escherichia coli expression system
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
14.1kDa
Escherichia coli expression system
10 ug
Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing.
<0.1 EU/μg
Ccl2
The activity is determined by the ability of MCP-1 to chemoattract THP-1 cells and is detectable starting at 10ng/mL.
Yes
P14844
Lyophilized
24770
Ccl2 (Rat) Recombinant Protein
1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN
RUO
MCP-1/Scya2/Sigje
Ccl2
Escherichia coli
None
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit