Abnova™ Rat Fgf2 (P13109, 10 a.a. - 154 a.a.) Partial Recombinant Protein

Used for Func, SDS-PAGE

Supplier:  Abnova™ P5037

Catalog No. 89-944-467

Description

Sequence: PALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Specifications

• Accession Number: P13109
• Formulation: Lyophilized
• Molecular Weight (g/mol): 16kDa
• Preparation Method: Escherichia coli expression system
• Quantity: 50 ug
• Storage Requirements: Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
• Endotoxin Concentration: Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be <0.1ng/μg (1EU/μg).
• Common Name: Fgf2
• Biological Activity: The ED(50) determined by dose-dependent stimulation of thymidine uptake by 3T3 cells expressing FGF receptors, was ofund to be < 1ng/mL.
• Recombinant: Recombinant
• Expression System: Escherichia coli expression system
• Purity or Quality Grade: >90% by SDS-PAGE and HPLC

• For Use With (Application): Functional Study, SDS-PAGE
• Gene ID (Entrez): 54250
• Name: Fgf2 (Rat) Recombinant Protein
• Purification Method: Ion exchange column and HPLC reverse phase column
• Immunogen: PALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
• Regulatory Status: RUO
• Gene Alias: Fgf-2/bFGF
• Gene Symbol: Fgf2
• Species: E. coli
• Protein Tag: None
• Form: Lyophilized