Abnova™ Rat IL25 Recombinant Protein

Catalog No.	Quantity
89-948-843	10 μg

Catalog No. 89-948-843 Supplier Abnova™ Supplier No. P4845

Description

Used for Func, SDS-PAGE

The protein encoded by this gene is a cytokine that shares the sequence similarity with IL17. This cytokine can induce NF-kappaB activation, and stimulate the production of IL8. Both this cytokine and IL17B are ligands for the cytokine receptor IL17BR. Studies of the similar gene in mice suggested that this cytokine may be a proinflammatory cytokine favoring Th2-type immune response. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq]

Sequence: CSHLPRCCPSKQQEFPEEWLKWNPAPVSPPEPLRHTHHPESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPMGNSVPLYHNQTVFYRRPCHGEQGAHGRYCLERRLYRVSLACVCVRPRMMA

Specifications

• Accession Number: D3ZLB1
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 64806
• Molecular Weight (g/mol): 35.5kDa
• Name: IL25 (Rat) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Quality Control Testing: 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
• Quantity: 10 μg
• Immunogen: MCSHLPRCCPSKQQEFPEEWLKWNPAPVSPPEPLRHTHHPESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPMGNSVPLYHNQTVFYRRPCHGEQGAHGRYCLERRLYRVSLACVCVRPRMMA
• Storage Requirements: Store at -20°C on dry atmosphere. After reconstitution with sterilized 20 mM HCl, store at -20°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1 EU/μg
• Gene Alias: IL-17E/IL-25/IL17E
• Common Name: IL25
• Gene Symbol: IL25
• Biological Activity: The activity is determined by the dose-dependent induction of human IL-8 production from human PBMCs. The expected ED50 for this effect is 25-37.5ng/mL.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Lyophilized