Novus Biologicals™ RDH16 Recombinant Protein Antigen

Catalog No.	Quantity
NBP187117PE	0.1 mL

Catalog No. NBP187117PE Supplier Novus Biologicals™ Supplier No. NBP187117PEP

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RDH16. The RDH16 Recombinant Protein Antigen is derived from E. coli. The RDH16 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-87117. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

• Gene ID (Entrez): 8608
• Species: Human
• Purification Method: Chromatography
• Purity: >80%
• Concentration: 0.5mg/mL
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: EC 1.1, EC 1.1.1, EC 1.1.1.105, Microsomal NAD+-dependent retinol dehydrogenase 4, retinol dehydrogenase 16, retinol dehydrogenase 16 (all-trans and 13-cis), retinol dehydrogenase 16 (all-trans), RODH4, RODH-4, SDR9C8, short chain dehydrogenase/reductase family 9C, member 8, Sterol/retinol dehydrogenase
• Gene Symbol: RDH16
• Label Type: Unlabeled
• Molecular Weight (g/mol): 25kDa
• Product Type: RDH16
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87117. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
• Immunogen: GVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVT

For Research Use Only