Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. NBC118524

Novus Biologicals™ Recombinant Arthrobacter globiformis DMGO His Protein
SDP

Catalog No. NBC118524 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBC118524 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118524 Supplier Novus Biologicals™ Supplier No. NBC118524
Only null left
Add to Cart
Add to Cart

Description

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-830 of Arthrobacter globiformis DMGO The Recombinant Bacteria DMGO Protein is derived from E. coli. The Recombinant Bacteria DMGO Protein has been validated for the following applications: SDS-Page.

Specifications

Concentration 1 mg/mL
For Use With (Application) SDS-PAGE
Formulation 20 mM Tris-HCl buffer (pH 8.0), 20% glycerol
Molecular Weight (g/mol) M.W. (theoretical): 92.1 kDa
Name DMGO Protein
Purification Method Protein
Quantity 0.1 mg
Immunogen MGSSHHHHHHSSGLVPRGSHMASTPRIVIIGAGIVGTNLADELVTRGWNNITVLDQGPLNMPGGSTSHAPGLVFQTNPSKTMASFAKYTVEKLLSLTEDGVSCFNQVGGLEVATTETRLADLKRKLGYAAAWGIEGRLLSPAECQELYPLLDGENILGGLHVPSDGLASAARAVQLLIKRTESAGVTYRGSTTVTGIEQSGGRVTGVQTADGVIPADIVVSCAGFWGAKIGAMIGMAVPLLPLAHQYVKTTPVPA
Storage Requirements Store at 4 C short term. Aliquot and store (at -20 C long term. Avoid freeze-thaw cycles.)
Research Category Proteases & Other Enzymes
Purity or Quality Grade >95%, by SDS-PAGE
Protein Arthrobacter globiformis DMGO
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.