Learn More
Novus Biologicals™ Recombinant Arthrobacter globiformis DMGO His Protein
Shop All R&D Systems Products

Description
Specifications
Specifications
| Concentration | 1 mg/mL |
| For Use With (Application) | SDS-PAGE |
| Formulation | 20 mM Tris-HCl buffer (pH 8.0), 20% glycerol |
| Molecular Weight (g/mol) | M.W. (theoretical): 92.1 kDa |
| Name | DMGO Protein |
| Purification Method | Protein |
| Quantity | 0.1 mg |
| Immunogen | MGSSHHHHHHSSGLVPRGSHMASTPRIVIIGAGIVGTNLADELVTRGWNNITVLDQGPLNMPGGSTSHAPGLVFQTNPSKTMASFAKYTVEKLLSLTEDGVSCFNQVGGLEVATTETRLADLKRKLGYAAAWGIEGRLLSPAECQELYPLLDGENILGGLHVPSDGLASAARAVQLLIKRTESAGVTYRGSTTVTGIEQSGGRVTGVQTADGVIPADIVVSCAGFWGAKIGAMIGMAVPLLPLAHQYVKTTPVPA |
| Storage Requirements | Store at 4 C short term. Aliquot and store (at -20 C long term. Avoid freeze-thaw cycles.) |
| Research Category | Proteases & Other Enzymes |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.