Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Recombinant Arthrobacter globiformis DMGO His Protein
SDP

Catalog No. NBC118524
Click to view available options
Quantity:
0.1 mg

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-830 of Arthrobacter globiformis DMGO The Recombinant Bacteria DMGO Protein is derived from E. coli. The Recombinant Bacteria DMGO Protein has been validated for the following applications: SDS-Page.

Specifications

Concentration 1 mg/mL
For Use With (Application) SDS-PAGE
Formulation 20 mM Tris-HCl buffer (pH 8.0), 20% glycerol
Molecular Weight (g/mol) M.W. (theoretical): 92.1 kDa
Name DMGO Protein
Purification Method Protein
Quantity 0.1 mg
Immunogen MGSSHHHHHHSSGLVPRGSHMASTPRIVIIGAGIVGTNLADELVTRGWNNITVLDQGPLNMPGGSTSHAPGLVFQTNPSKTMASFAKYTVEKLLSLTEDGVSCFNQVGGLEVATTETRLADLKRKLGYAAAWGIEGRLLSPAECQELYPLLDGENILGGLHVPSDGLASAARAVQLLIKRTESAGVTYRGSTTVTGIEQSGGRVTGVQTADGVIPADIVVSCAGFWGAKIGAMIGMAVPLLPLAHQYVKTTPVPA
Storage Requirements Store at 4 C short term. Aliquot and store (at -20 C long term. Avoid freeze-thaw cycles.)
Research Category Proteases & Other Enzymes
Purity or Quality Grade >95%, by SDS-PAGE
Protein Arthrobacter globiformis DMGO
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.