Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. NBC118417

Novus Biologicals™ Recombinant Drosophila GAGA-POZ domain Protein
SDP

Catalog No. NBC118417 Shop All R&D Systems Products
Change view
Click to view available options
:
0.1mg; Unlabeled
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No.
NBC118417 0.1mg; Unlabeled
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118417 Supplier Novus Biologicals™ Supplier No. NBC118417
Only null left
Add to Cart
Add to Cart

Description

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids 1-130 of Drosophila melanogaster GAGA-POZ domain The Recombinant Drosophila GAGA-POZ domain Protein is derived from E. coli. The Recombinant Drosophila GAGA-POZ domain Protein has been validated for the following applications: SDS-Page.

Specifications

For Use With (Application) ELISA, SDS-PAGE
Formulation 10mM HEPES buffer (pH7.4), 25mM NaCl
Molecular Weight (g/mol) 14kDa
Name GAGA-POZ domain Protein
Purification Method Protein
Immunogen MSLPMNSLYSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGRSFPAHKIVLCAASPFLLDLLKNTPCKHPVVMLAGVNANDLEALLEFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTVTKDDYTTH
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Cross Reactivity Drosophila
Research Category Cell Cycle and Replication
Purity or Quality Grade >95%, by SDS-PAGE
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.