Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Recombinant E. coli HSP70/HSPA1A Protein
SDP

Catalog No. NBC118358
Click to view available options
:
0.1mg; Unlabeled

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids 1-384 of E.coli HSP70/HSPA1A The Recombinant E. coli HSP70/HSPA1A Protein is derived from E. coli. The Recombinant E. coli HSP70/HSPA1A Protein has been validated for the following applications: SDS-Page.

Specifications

For Use With (Application) ELISA, SDS-PAGE
Formulation 25mM Tris-HCl buffer (pH7.5), 100mM NaCl, 5mM DTT, 10% glycerol
Gene ID (Entrez) 3303
Molecular Weight (g/mol) 41.6kDa
Name HSP70/HSPA1A Protein
Purification Method Protein
Immunogen MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRN (NP_414555)
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Purity or Quality Grade >95%, by SDS-PAGE
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.