Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ Recombinant E. coli HSP70/HSPA1A Protein

Click to view available options
:
0.1mg; Unlabeled
Description
An un-tagged recombinant protein corresponding to the amino acids 1-384 of E.coli HSP70/HSPA1A The Recombinant E. coli HSP70/HSPA1A Protein is derived from E. coli. The Recombinant E. coli HSP70/HSPA1A Protein has been validated for the following applications: SDS-Page.
Specifications
Specifications
For Use With (Application) | ELISA, SDS-PAGE |
Formulation | 25mM Tris-HCl buffer (pH7.5), 100mM NaCl, 5mM DTT, 10% glycerol |
Gene ID (Entrez) | 3303 |
Molecular Weight (g/mol) | 41.6kDa |
Name | HSP70/HSPA1A Protein |
Purification Method | Protein |
Immunogen | MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRN (NP_414555) |
Storage Requirements | −80°C. Avoid freeze-thaw cycles. |
Purity or Quality Grade | >95%, by SDS-PAGE |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction