Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Recombinant E. coli HSP70/HSPA1A Protein
SDP

Catalog No. NBC118359 Shop All R&D Systems Products
Change view
Click to view available options
:
0.1mg; Unlabeled
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No.
NBC118359 0.1mg; Unlabeled
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118359 Supplier Novus Biologicals™ Supplier No. NBC118359
Only null left
Add to Cart
Add to Cart

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids 385-638 of E.coli HSP70/HSPA1A The Recombinant E. coli HSP70/HSPA1A Protein is derived from E. coli. The Recombinant E. coli HSP70/HSPA1A Protein has been validated for the following applications: SDS-Page.

Specifications

For Use With (Application) ELISA, SDS-PAGE
Formulation 25mM Tris-HCl buffer (pH7.5), 100mM NaCl, 5mM DTT, 10% glycerol
Gene ID (Entrez) 3303
Molecular Weight (g/mol) 27.7kDa
Name HSP70/HSPA1A Protein
Purification Method Protein
Immunogen MDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVKDKK
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Purity or Quality Grade >95%, by SDS-PAGE
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.