Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)
SDP

Catalog No. NB254789100 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
200 μg
500 μg
3 product options available for selection
Product selection table with 3 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB254789100 100 μg
NB398315 200 μg
NB398314 500 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 3 options available.
3 options
Catalog No. NB254789100 Supplier Novus Biologicals™ Supplier No. NBP254789100UG
Only null left
Add to Cart
Add to Cart

Description

Highly purified and high bioactivity. Generating reliable and reproducible results.

An un-tagged full length Human biologically active Alpha-Synuclein recombinant protein aggregate (pre-formed fibrils, Type 1), NCBI Accession #: NP_000336.1. The Recombinant Human alpha-Synuclein Aggregate Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Aggregate Protein has been validated for the following applications: Western Blot, In vitro assay, In vivo assay, SDS-Page, Bioactivity.

Specifications

For Use With (Application) In vitro Assay, In vivo Assay, SDS-PAGE, Western Blot
Formulation PBS
Gene ID (Entrez) 6622
Name Human alpha-Synuclein Aggregate Protein
Purification Method >95% pure by SDS-PAGE
Quantity 100 μg
Source E.Coli
Immunogen MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Storage Requirements Store at −80°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Gene Alias alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
Gene Symbol SNCA
Biological Activity Endogenous alpha-synuclein phosphorylation. 100μM alpha synuclein protein monomer seeded with 10nM alpha synuclein protein aggregate in 25μM Thioflavin T (PBS pH 7.4, 100μL reaction volume) generated a fluorescence intensity of 13,000 Relative Fluorescence Units after incubation at 37°C with shaking at 600 rpm for 24 hours. Fluorescence was measured by excitation at 450nm and emission at 485nm on a Molecular Devices Gemini XPS microplate reader.
Product Type Recombinant Protein
Conjugate Unconjugated
Cross Reactivity Human
Recombinant Recombinant
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.