Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)
Highly purified and high bioactivity. Generating reliable and reproducible results.
Manufacturer: Novus Biologicals™ NBP254789100UG
Description
An un-tagged full length Human biologically active Alpha-Synuclein recombinant protein aggregate (pre-formed fibrils, Type 1), NCBI Accession #: NP_000336.1. The Recombinant Human alpha-Synuclein Aggregate Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Aggregate Protein has been validated for the following applications: Western Blot, In vitro assay, In vivo assay, SDS-Page, Bioactivity.Specifications
Western Blot, In vitro assay, In vivo assay, SDS-Page | |
6622 | |
>95% pure by SDS-PAGE | |
E.Coli | |
Store at −80°C. Avoid freeze-thaw cycles. | |
alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor) | |
Endogenous alpha-synuclein phosphorylation. 100μM alpha synuclein protein monomer seeded with 10nM alpha synuclein protein aggregate in 25μM Thioflavin T (PBS pH 7.4, 100μL reaction volume) generated a fluorescence intensity of 13,000 Relative Fluorescence Units after incubation at 37°C with shaking at 600 rpm for 24 hours. Fluorescence was measured by excitation at 450nm and emission at 485nm on a Molecular Devices Gemini XPS microplate reader. | |
Unlabeled | |
Yes |
PBS | |
Human alpha-Synuclein Aggregate Protein | |
100μg | |
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA | |
RUO | |
SNCA | |
Recombinant Protein | |
Human |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title