Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Recombinant Human beta-Synuclein Protein
SDP

Catalog No. NBC118328 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBC118328 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118328 Supplier Novus Biologicals™ Supplier No. NBC118328
Only null left
Add to Cart
Add to Cart

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids 1-134 of Human beta-Synuclein The Recombinant Human beta-Synuclein Protein is derived from E. coli. The Recombinant Human beta-Synuclein Protein has been validated for the following applications: SDS-Page.

Specifications

Accession Number NP_001001502.1
For Use With (Application) ELISA, SDS-PAGE
Formulation 20mM Tris-HCl buffer (pH 7.5), 0.1 M NaCl, 1mM MgCl2
Gene ID (Entrez) 6620
Molecular Weight (g/mol) 14.2kDa
Name Synuclein-beta Protein
Purification Method Protein
Quantity 0.1 mg
Source E. Coli
Immunogen MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Purity or Quality Grade >95%, by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.