Learn More
R&D Systems™ Recombinant Human CD44v6 Fc Chimera Protein
Description
Specifications
Specifications
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. |
| Gene ID (Entrez) | 960 |
| Molecular Weight (g/mol) | M.W.-observed: 105-120 kDa, under reducing conditions., M.W.-theroretical: 59 kDa |
| Quantity | 50 μg |
| Source | Chinese Hamster Ovary cell line, CHO-derived human CD44 protein Human CD44v6 (Gln21-Thr222) (IQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAG)(Asp224-Trp269) (C-terminus) Accession # NP_001001391.1 GGIEGRMD Human IgG1 (Pro100-Lys330) (N-terminus) |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 3 months, -20°C to -70°C under sterile conditions after reconstitution. |
| Endotoxin Concentration | <0.10 EU / 1 μg of the protein by the LAL method. |
| Gene Alias | CD44 antigen, CD44 molecule (Indian blood group), CD44R, CDw44, cell surface glycoprotein CD44, chondroitin sulfate proteoglycan 8, CSPG8, ECMR-III, Epican, Extracellular matrix receptor III, GP90 lymphocyte homing/adhesion receptor, HCELL, hematopoietic cell E- and L-selectin ligand, Heparan sulfate proteoglycan, Hermes antigen, homing function and Indian blood group system, HUTCH-I, Hyaluronate receptor, IN, LHR, MC56, MDU2CD44 antigen (homing function and Indian blood group system), MDU3CDW44, MIC4MGC10468, Pgp1, PGP-1, PGP-I, Phagocytic glycoprotein 1, Phagocytic glycoprotein I |
| Conjugate | Unconjugated |
| Reconstitution | Reconstitute at 500 μg/mL in PBS. |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.