Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

R&D Systems™ Recombinant Human CD44v6 Fc Chimera Protein

Catalog No. 11175CD050
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
11175CD050 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Catalog No. 11175CD050 Supplier R&D Systems™ Supplier No. 11175CD050
Add to Cart
Add to Cart
This item is not returnable. View return policy
Measured by its binding ability in a functional ELISA. When Recombinant Human CD44v6 Fc Chimera (Catalog # 11175-CD) is immobilized at 1 μg/mL (100 μL/well), Biotinylated Hyaluronan binds with an ED50 of 4.00-40.0 ng/mL.

Specifications

Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Gene ID (Entrez) 960
Molecular Weight (g/mol) M.W.-observed: 105-120 kDa, under reducing conditions., M.W.-theroretical: 59 kDa
Quantity 50 μg
Source Chinese Hamster Ovary cell line, CHO-derived human CD44 protein Human CD44v6 (Gln21-Thr222) (IQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAG)(Asp224-Trp269) (C-terminus) Accession # NP_001001391.1 GGIEGRMD Human IgG1 (Pro100-Lys330) (N-terminus)
Storage Requirements Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 3 months, -20°C to -70°C under sterile conditions after reconstitution.
Endotoxin Concentration <0.10 EU / 1 μg of the protein by the LAL method.
Gene Alias CD44 antigen, CD44 molecule (Indian blood group), CD44R, CDw44, cell surface glycoprotein CD44, chondroitin sulfate proteoglycan 8, CSPG8, ECMR-III, Epican, Extracellular matrix receptor III, GP90 lymphocyte homing/adhesion receptor, HCELL, hematopoietic cell E- and L-selectin ligand, Heparan sulfate proteoglycan, Hermes antigen, homing function and Indian blood group system, HUTCH-I, Hyaluronate receptor, IN, LHR, MC56, MDU2CD44 antigen (homing function and Indian blood group system), MDU3CDW44, MIC4MGC10468, Pgp1, PGP-1, PGP-I, Phagocytic glycoprotein 1, Phagocytic glycoprotein I
Conjugate Unconjugated
Reconstitution Reconstitute at 500 μg/mL in PBS.
Purity or Quality Grade >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie™ Blue Staining.
Protein CD44
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.