Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. NB11850305

Novus Biologicals™ Recombinant Human FABP1/L-FABP Protein
SDP

Catalog No. NB11850305 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.5 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB11850305 0.5 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB11850305 Supplier Novus Biologicals™ Supplier No. NBC1185030.5MG
Only null left
Add to Cart
Add to Cart

Description

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to amino acids: 1 - 127 of FABP1. The Recombinant Human FABP1/L-FABP Protein is derived from E. coli. The Recombinant Human FABP1/L-FABP Protein has been validated for the following applications: SDS-Page.

Specifications

Accession Number NP_006399
Concentration 1mg/mL
For Use With (Application) SDS-PAGE
Formulation 20mM Tris pH 8.0
Gene ID (Entrez) 2168
Molecular Weight (g/mol) 16kDa
Name Human FABP1/L-FABP Protein
Purification Method >95% pure by SDS-PAGE
Quantity 0.5 mg
Source E.Coli
Immunogen MGSSHHHHHHSSGLVPRGSHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Endotoxin Concentration <1.0 EU per 1μg of protein (determined by LAL method)
Gene Alias FABPL, fatty acid binding protein 1, liver, fatty acid-binding protein, liver, L-FABPFatty acid-binding protein 1, Liver-type fatty acid-binding protein
Gene Symbol FABP1
Product Type Recombinant Protein
Conjugate Unconjugated
Cross Reactivity Human
Recombinant Recombinant
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.