Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ Recombinant Human IPP Protein

Click to view available options
:
0.1mg; Unlabeled
Description
An un-tagged recombinant protein corresponding to the amino acids 1-157 of Human E.coli IPP The Recombinant Human IPP Protein is derived from E. coli. The Recombinant Human IPP Protein has been validated for the following applications: SDS-Page.
Specifications
Specifications
Accession Number | NP_005888 |
For Use With (Application) | ELISA, SDS-PAGE |
Formulation | 10mM HEPES buffer (pH7.4), 25mM NaCl |
Gene ID (Entrez) | 3652 |
Molecular Weight (g/mol) | 17.3kDa |
Name | IPP Protein |
Purification Method | Protein |
Immunogen | MANEDCPKAADSPFSSDKHAQLILAQINKMRNGQHFCDVQ502510155025101514%SDS-PAGELQVGQESFKAHRLVLAASSPYFAALFTGGMKESSKDVVPILGIEAGIFQILLDFIYTGIVNIGVNNVQELIIAADMLQLTEVVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEF |
Storage Requirements | −80°C. Avoid freeze-thaw cycles. |
Cross Reactivity | Human |
Show More |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction