Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Recombinant Human IPP Protein
SDP

Catalog No. NBC118418 Shop All R&D Systems Products
Click to view available options
:
0.1mg; Unlabeled

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids 1-157 of Human E.coli IPP The Recombinant Human IPP Protein is derived from E. coli. The Recombinant Human IPP Protein has been validated for the following applications: SDS-Page.

Specifications

Accession Number NP_005888
For Use With (Application) ELISA, SDS-PAGE
Formulation 10mM HEPES buffer (pH7.4), 25mM NaCl
Gene ID (Entrez) 3652
Molecular Weight (g/mol) 17.3kDa
Name IPP Protein
Purification Method Protein
Immunogen MANEDCPKAADSPFSSDKHAQLILAQINKMRNGQHFCDVQ502510155025101514%SDS-PAGELQVGQESFKAHRLVLAASSPYFAALFTGGMKESSKDVVPILGIEAGIFQILLDFIYTGIVNIGVNNVQELIIAADMLQLTEVVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEF
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Cross Reactivity Human
Research Category Cell Cycle and Replication
Purity or Quality Grade >95%, by SDS-PAGE
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.