Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. NBC118434

Novus Biologicals™ Recombinant Human PPIH Protein
SDP

Catalog No. NBC118434 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBC118434 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBC118434 Supplier Novus Biologicals™ Supplier No. NBC118434
Only null left
Add to Cart
Add to Cart

Description

Highly purified and high bioactivity. Generating reliable and reproducible results.

Specific activity is > 220 nmol/min/mg, and is defined as the amount of enzyme that cleaves 1umole of suc-AAPF-pNA per minute at 25C in Tris-Hcl pH8.0 using chymotrypsin.

Specifications

Accession Number NP_006338
For Use With (Application) Bioactivity, SDS-PAGE
Formulation PBS (pH 7.4), 10% glycerol
Gene ID (Entrez) 10465
Molecular Weight (g/mol) 19.2kDa
Name PPIH Protein
Purification Method Protein
Quantity 0.1 mg
Source E. Coli
Immunogen 1-177aa, MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Research Category Cell Cycle and Replication
Purity or Quality Grade >95%, by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.