Novus Biologicals™ REEP5 Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human REEP5. Source: E.coli Amino Acid Sequence: PSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEE The REEP5 Recombinant Protein Antigen is derived from E. coli. The REEP5 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 7905
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: REEP5 Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: C5orf18polyposis coli region hypothetical protein DP1, chromosome 5 open reading frame 18, D5S346deleted in polyposis 1, DP1TB2YOP1, MGC70440, Polyposis locus protein 1, Protein TB2, receptor accessory protein 5, receptor expression enhancing protein 5, r
• Gene Symbol: REEP5
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53190. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only.