Learn More
Description
This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified.
- Theoretical MW (kDa): 42.90
- Preparation Method: In vitro wheat germ expression system
- Purification:Glutathione Sepharose 4 fast flow
- Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
Specifications
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Molecular Weight (g/mol) | 42.9 |
| Name | Human RNASE1 Full-length ORF Recombinant Protein with GST-tag at N-terminal |
| pH Range | 8 |
| Preparation Method | In vitro wheat germ expression system |
| Purification Method | Glutathione Sepharose 4 Fast Flow |
| Quality Control Testing | 12.5% SDS-PAGE stained with Coomassie Blue |
| Quantity | 25 μg |
| Source | Wheat Germ (in vitro) |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.