Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89934873

RPS6KA3 Rabbit anti-Human, Mouse, Rat, Polyclonal , Abnova™

Catalog No. 89934873 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-934-873 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-934-873 Supplier Abnova Corporation Supplier No. PAB29387
Only null left
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against recombinant human RPS6KA3.

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Mutations in this gene have been associated with Coffin-Lowry syndrome (CLS). [provided by RefSeq]

Sequence: MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLY

Specifications

Antigen RPS6KA3
Applications Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against recombinant human RPS6KA3.
Dilution Immunohistochemistry (1:500-1:1000) Immunofluorescence (1-4 ug/mL) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene Alias CLS/HU-3/ISPK-1/MAPKAPK1B/MRX19/RSK/RSK2/S6K-alpha3/p90-RSK2/pp90RSK2
Gene Symbols RPS6KA3
Host Species Rabbit
Immunogen Recombinant protein corresponding to human RPS6KA3.
Purification Method Antigen affinity purification
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6197
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.