Novus Biologicals™ RSF1 Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RSF1. Source: E.coli Amino Acid Sequence: KYLCECQFDDNLKFKNIINEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQDDQDGSSWKCIVRNRNELAETLALLKAQIDPVLLK The RSF1 Recombinant Protein Antigen is derived from E. coli. The RSF1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 51773
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: RSF1 Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
• Formulation: PBS and 1M Urea, pH 7.4
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: HBV pX associated protein-8, HBXAPp325 subunit of RSF chromatin-remodeling complex, hepatitis B virus x associated protein, Hepatitis B virus X-associated protein, p325, remodeling and spacing factor 1, Rsf-1, XAP8HBV pX-associated protein 8
• Gene Symbol: RSF1
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51490. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For research use only.