Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89968814

Abnova™ SCAP2 (Human) Recombinant Protein (P02)

Catalog No. 89968814 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
2 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-968-814 2 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-968-814 Supplier Abnova™ Supplier No. H00008935P02
Add to Cart
Add to Cart

Description

Human Recombinant Protein

Human SCAP2 full-length ORF ( AAH36044, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal.

Specifications

Accession Number AAH36044
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer
Gene ID (Entrez) 8935
Name src kinase associated phosphoprotein 2
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue
Quantity 2 μg
Source Wheat Germ (in vitro)
Storage Requirements Store at -80°C Aliquot to avoid repeated freezing and thawing
Gene Alias MGC10411,MGC33304,PRAP,RA70,SAPS,SCAP2,SKAP-HOM,SKAP55R
Common Name SKAP2
Recombinant Recombinant
Sequence MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI
Target Species Named Human
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.