Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ SERCA1 ATPase Polyclonal Antibody

Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA578835
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Skeletal Muscle Tissue, Mouse Skeletal Muscle Tissue. IHC: Rat Skeletal Muscle Tissue, Mouse Skeletal Muscle Tissue.
ATP dependent calcium pumps are responsible, in part, for the maintenance of low cytoplasmic free calcium concentrations. The ATP pumps that reside in intracellular organelles are encoded by a family of structurally related enzymes, termed the sarcoplasmic or endoplasmic reticulum calcium (SERCA) ATPases. The SERCA1 gene is exclusively expressed in type II (fast) skeletal muscle. The SERCA2 gene is subject to tissue dependent processing which is responsible for the generation of SERCA2a muscle-specific form expressed in type I (slow) skeletal, cardiac and smooth muscle and the SERCA2b isoform expressed in all cell types. The SERCA3 gene is not as well characterized and is found in non-muscle cells.
Specifications
| SERCA1 ATPase | |
| Polyclonal | |
| Unconjugated | |
| ATP2A1 | |
| adult Ca2+ ATPase; ATP2A; ATP2A1; ATP2A3; ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1; ATPase, Ca++ transporting, cardiac muscle, fast twitch 1; ATPase, Ca++ transporting, ubiquitous; Ca2+ ATPase; calcium pump 1; Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle isoform; endoplasmic reticulum class 1/2 Ca(2+) ATPase; neonatal Ca2+ ATPase; sarcoplasmic/endoplasmic reticulum calcium ATPase 1; SERCA; SERCA ATPase; Serca1; SERCA1a; SR Ca(2+)-ATPase 1 | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 116601, 11937, 487 | |
| -20°C | |
| Lyophilized |
| Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry | |
| 500 μg/mL | |
| PBS with 5mg BSA and 0.05mg sodium azide | |
| O14983, Q64578, Q8R429 | |
| ATP2A1 | |
| A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA1 ATPase (1-32aa MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN). | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction