Invitrogen™ SFTPB Polyclonal Antibody

Catalog No.	Quantity
PIPA595506	100 μg

Catalog No. PIPA595506 Supplier Invitrogen™ Supplier No. PA595506

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human MCF-7 whole cell, human COLO-320 whole cell, human HepG2 whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Pulmonary surfactant is a complex mixture of phospholipids and proteins that is secreted from type II cells in alveoli and reduces the surface tension at the alveolar air-liquid interface, providing alveolar stability necessary for normal ventilation. Four distinct proteins isolated from pulmonary surfactant are termed surfactant proteins A, B, C, and D. SP-A (28-36kDa) and SP-D (43kDa) are collagenous carbohydrate-binding proteins, whereas SP-B (8-9kDa) and SP-C (4kDa) are non-collagenous hydrophobic proteins. SP-B is expressed in pulmonary adenocarcinomas with acinar, papillary, bronchioloalveolar, and solid growth patterns. Squamous cell and large cell carcinomas of the lung and nonpulmonary adenocarcinomas do not express SP-B. ProSP-B is glycosylated in the Golgi apparatus and undergoes carboxy- and amino-terminal proteolysis by a cathepsin D-like protease.

Specifications

• Antigen: SFTPB
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene: SFTPB
• Gene Accession No.: P07988, P22355, P50405
• Gene Alias: 18 kDa pulmonary-surfactant protein; 6 kDa protein; AI562151; P SFTB3; pot. surfactant-associated protein precursor; putative; preproprotein; PSP-B; Pulmonary surfactant protein 18; pulmonary surfactant protein B; pulmonary surfactant-associated protein B; pulmonary surfactant-associated protein B precursor; pulmonary surfactant-associated protein B; LOW QUALITY PROTEIN: pulmonary surfactant-associated protein B; Pulmonary surfactant-associated proteolipid SPL(Phe); SF-B; SFPB; SFTB3; SFTP3; Sftp-3; Sftpb; SMDP1; SP 18; SP-B; SPBS; surfactant associated protein B; surfactant protein B; surfactant protein-B; surfactant pulmonary-associated protein B; surfactant, pulmonary-associated protein B
• Gene Symbols: SFTPB
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence of human SFTPB (QCLAERYSVILLDTLLGRMLPQLVCRLVLR).
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 192155, 20388, 6439
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG