Invitrogen™ SHIP1 Polyclonal Antibody

Catalog No.	Quantity
PIPA595525	100 μg

Catalog No. PIPA595525 Supplier Invitrogen™ Supplier No. PA595525

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human CCRF-CEM whole cell, human SW620 whole cell. IHC: human tonsil tissue, mouse spleen tissue, rat spleen tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted to hematopoietic cells where its movement from the cytosol to the plasma membrane is mediated by tyrosine phosphorylation. At the plasma membrane, the protein hydrolyzes the 5' phosphate from phosphatidylinositol (3,4,5)-trisphosphate and inositol-1,3,4,5-tetrakisphosphate, thereby affecting multiple signaling pathways. Overall, the protein functions as a negative regulator of myeliod cell proliferation and survival. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Specifications

• Antigen: SHIP1
• Applications: Immunohistochemistry (Paraffin), Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene: INPP5D
• Gene Accession No.: P97573, Q92835, Q9ES52
• Gene Alias: 7a33; hp51CN; Inositol polyphosphate-5-phosphatase 145 kDa; inositol polyphosphate-5-phosphatase D; Inositol polyphosphate-5-phosphatase of 145 kDa; inositol polyphosphate-5-phosphatase, 145 kDa; inositol polyphosphate-5-phosphatase, 145kD; inositol polyphosphate-5-phosphatase, 145kDa; Inpp5d; MGC104855; MGC142140; MGC142142; OTTHUMP00000165069; OTTHUMP00000165070; OTTHUMP00000165071; OTTHUMP00000165072; OTTHUMP00000203442; p150Ship; phosphatidylin; Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1; Phosphatidylinositol 4,5-bisphosphate 5-phosphatase; phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1; Phosphatidylinositol-4,5-bisphosphate 5-phosphatase; SH2 domain-containing inositol 5'-phosphatase 1; SH2 domain-containing inositol phosphatase 1; SH2 domain-containing inositol-5'-phosphatase 1; SH2-containing inositol phosphatase SHIP; SHIP; SHIP1; SHIP-1; signaling inositol polyphosphate 5 phosphatase SIP-145; signaling inositol polyphosphate phosphatase SHIP II; SIP-145; Src homology 2 domain-containing inositol-5-phosphatase; s-SHIP
• Gene Symbols: INPP5D
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence of human SHIP (NEDDKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQ).
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 16331, 3635, 54259
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG