Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. NBP257119PE

Novus Biologicals™ SLC17A9 Recombinant Protein Antigen
SDP

Catalog No. NBP257119PE Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP257119PE 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP257119PE Supplier Novus Biologicals™ Supplier No. NBP257119PEP

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC17A9. Source: E.coli Amino Acid Sequence: KDLILALGVLAQSRPVSRHSRVPWRRLFRKPA The SLC17A9 Recombinant Protein Antigen is derived from E. coli. The SLC17A9 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

Gene ID (Entrez) 63910
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name SLC17A9 Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias C20orf59, Chromosome 20 Open Reading Frame 59, Solute Carrier Family 17 (Vesicular Nucleotide Transporter), Member 9, Solute Carrier Family 17 Member 9, Solute Carrier Family 17, Member 9, Vesicular Nucleotide Transporter SLC17A9, VNUT
Gene Symbol SLC17A9
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51529. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Show More Show Less

For Research Use Only.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.