Invitrogen™ SLC34A2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA5143910

Catalog No. PIPA5143910

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Positive Control - WB: human 293T whole cell, human HepG2 whole cell. IHC: human lung cancer tissue, mouse lung tissue, rat lung tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

SLC34A2 encodes a protein that is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.

Specifications

• Antigen: SLC34A2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: SLC34A2
• Gene Alias: AA536683; D5Ertd227e; Na(+)/Pi cotransporter 2B; Na(+)-dependent phosphate cotransporter 2B; NAPI IIb; NaPi-2b; NaPi3b; NAPI-3B; NAPI-IIb; Npt2b; NPTIIb; rNaPi IIb; Slc34a2; Sodium/phosphate cotransporter 2B; Sodium-dependent phosphate transport protein 2B; sodium-phosphate transport protein 2B; solute carrier family 34 (sodium phosphate), member 2; solute carrier family 34 (type II sodium/phosphate contransporter), member 2; solute carrier family 34 (type II sodium/phosphate cotransporter), member 2; solute carrier family 34 member 2; type II sodium-dependent phosphate transporter 3b; type IIb Na/Picotransporter; type IIb sodium-phosphate transporter
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 10568, 20531, 84395
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot, Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: O95436, Q9DBP0, Q9JJ09
• Gene Symbols: SLC34A2
• Immunogen: A synthetic peptide corresponding to a sequence of human SLC34A2 (QNWTMKNVTYKENIAKCQHIFVNFHLPDLA).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG