Learn More
Invitrogen™ SLC34A2 Polyclonal Antibody

Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA5143910
Description
Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Positive Control - WB: human 293T whole cell, human HepG2 whole cell. IHC: human lung cancer tissue, mouse lung tissue, rat lung tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
SLC34A2 encodes a protein that is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.
Specifications
| SLC34A2 | |
| Polyclonal | |
| Unconjugated | |
| SLC34A2 | |
| AA536683; D5Ertd227e; Na(+)/Pi cotransporter 2B; Na(+)-dependent phosphate cotransporter 2B; NAPI IIb; NaPi-2b; NaPi3b; NAPI-3B; NAPI-IIb; Npt2b; NPTIIb; rNaPi IIb; Slc34a2; Sodium/phosphate cotransporter 2B; Sodium-dependent phosphate transport protein 2B; sodium-phosphate transport protein 2B; solute carrier family 34 (sodium phosphate), member 2; solute carrier family 34 (type II sodium/phosphate contransporter), member 2; solute carrier family 34 (type II sodium/phosphate cotransporter), member 2; solute carrier family 34 member 2; type II sodium-dependent phosphate transporter 3b; type IIb Na/Picotransporter; type IIb sodium-phosphate transporter | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 10568, 20531, 84395 | |
| -20°C | |
| Lyophilized |
| Immunohistochemistry (Paraffin), Western Blot, Immunohistochemistry (Paraffin), Western Blot | |
| 500 μg/mL | |
| PBS with 4mg trehalose and no preservative | |
| O95436, Q9DBP0, Q9JJ09 | |
| SLC34A2 | |
| A synthetic peptide corresponding to a sequence of human SLC34A2 (QNWTMKNVTYKENIAKCQHIFVNFHLPDLA). | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.