Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ SLC34A2 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA5143910 Shop All Thermo Scientific Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA5143910 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA5143910 Supplier Invitrogen™ Supplier No. PA5143910
Add to Cart
Edge
Add to Cart

Rabbit Polyclonal Antibody

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Positive Control - WB: human 293T whole cell, human HepG2 whole cell. IHC: human lung cancer tissue, mouse lung tissue, rat lung tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

SLC34A2 encodes a protein that is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC34A2
Applications Immunohistochemistry (Paraffin), Western Blot, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene SLC34A2
Gene Accession No. O95436, Q9DBP0, Q9JJ09
Gene Alias AA536683; D5Ertd227e; Na(+)/Pi cotransporter 2B; Na(+)-dependent phosphate cotransporter 2B; NAPI IIb; NaPi-2b; NaPi3b; NAPI-3B; NAPI-IIb; Npt2b; NPTIIb; rNaPi IIb; Slc34a2; Sodium/phosphate cotransporter 2B; Sodium-dependent phosphate transport protein 2B; sodium-phosphate transport protein 2B; solute carrier family 34 (sodium phosphate), member 2; solute carrier family 34 (type II sodium/phosphate contransporter), member 2; solute carrier family 34 (type II sodium/phosphate cotransporter), member 2; solute carrier family 34 member 2; type II sodium-dependent phosphate transporter 3b; type IIb Na/Picotransporter; type IIb sodium-phosphate transporter
Gene Symbols SLC34A2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human SLC34A2 (QNWTMKNVTYKENIAKCQHIFVNFHLPDLA).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10568, 20531, 84395
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.