Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA580043

Invitrogen™ SMN1/SMN2 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA580043
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA580043 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA580043 Supplier Invitrogen™ Supplier No. PA580043
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, Mouse Brain Tissue, Rat Liver Tissue, Mouse Liver Tissue, 293T whole cell, SMMC whole cell, HEPG2 whole cell, HELA whole cell. IHC: Mouse Brain Tissue, Rat Brain Tissue, Human Mammary Cancer Tissue. ICC/IF: U20S cell. Flow: A431 cell.

The SMN1 gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. The telomeric and centromeric copies of this gene are nearly identical and encode the same protein - survival motor neuron protein. The SMN complex plays a catalyst role in the assemble of small nuclear ribonucleoproteins, the building blocks of the spliceosome. Mutations in the SMN1 gene are known to cause spinal muscular atrophy 1/2.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SMN1/SMN2
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene SMN1
Gene Accession No. O35876, P97801, Q16637
Gene Alias AI849087; BCD541; component of gems 1; Gemin1; Gemin-1; SMA; SMA@; SMA1; SMA2; SMA3; SMA4; Smn; SMN1; SMN2; SMNC; SMNT; survival motor neuron 1; survival motor neuron 1 protein; survival motor neuron protein; survival of motor neuron 1, telomeric; survival of motor neuron protein; T-BCD541; TDRD16A; tudor domain containing 16A
Gene Symbols SMN1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2 (22-52aa RRGTGQSDDSDIWDDTALIKAYDKAVASFKH).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 20595, 64301, 6606
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.