Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA595266

Invitrogen™ SOX5 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595266 Shop All Thermo Scientific Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595266 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595266 Supplier Invitrogen™ Supplier No. PA595266
  • $580.00
    $477.65 / Each of 1

    Save $102.35

    18% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Edge
Add to Cart

missing translation for 'validMainframeMsg'

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Liver Tissue, Rat Testis Tissue, Rat Brain Tissue, HELA whole cell, A549 whole cell, All lanes: pig adipose cells, mouse spleen tissue, mouse thymus tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SOX5
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene SOX5
Gene Accession No. P35710, P35711
Gene Alias A730017D01Rik; AI528773; LAMSHF; L-SOX5; L-SOX5B; L-SOX5F; MGC35153; Sox5; Sox-5; Sox5-BLM isoform; Sox5l1; SRY (sex determining region Y)-box 5; SRY box 5; SRY-box 5; SRY-box containing gene 5; SRY-box containing gene 5-like 1; SRY-box transcription factor 5; SRY-related HMG-box 5 protein; transcription factor SOX-5
Gene Symbols SOX5
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5 (495-528aa EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 100627965, 140587, 20678, 6660
Target Species Human, Mouse, Pig, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.