Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ SRD5A1 (Human) Recombinant Protein (P01)

Catalog No. 89968747 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
2 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-968-747 2 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-968-747 Supplier Abnova™ Supplier No. H00006715P01
Add to Cart
Add to Cart

Human Recombinant Protein

Human SRD5A1 full-length ORF ( AAH07033, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal.

Specifications

Accession Number AAH07033
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer
Gene ID (Entrez) 6715
Name steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue
Quantity 2 μg
Source Wheat Germ (in vitro)
Storage Requirements Store at -80°C Aliquot to avoid repeated freezing and thawing
Common Name SRD5A1
Recombinant Recombinant
Sequence MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF
Target Species Named Human
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.