Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIMA545607

Invitrogen™ SUR2A Monoclonal Antibody (N319A/14), APC
GREENER_CHOICE

Catalog No. PIMA545607
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIMA545607 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Catalog No. PIMA545607 Supplier Invitrogen™ Supplier No. MA545607
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

1 μg/mL of MA5-45607 was sufficient for detection of SUR2A in 20 μg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody. Detects approximately 120kDa. Does not cross-react with SUR2B. This antibody was formerly sold as clone S319A-14.

Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SUR2A
Applications Immunohistochemistry, Western Blot, Immunocytochemistry
Classification Monoclonal
Clone N319A/14
Concentration 1 mg/mL
Conjugate APC
Formulation 2.48mM MES, 95.46mM phosphate with 2mM EDTA and no preservative; pH 7.4
Gene ABCC9
Gene Accession No. O60706, P70170, Q63563
Gene Alias ABC37; ABCC9; AI414027; AI449286; ATFB12; ATP binding cassette subfamily C member 9; ATP-binding cassette sub-family C member 9; ATP-binding cassette transporter sub-family C member 9; ATP-binding cassette, subfamily C (CFTR/MRP), member 9; ATP-binding cassette, sub-family C (CFTR/MRP), member 9; CANTU; cardiac ventricle sulfonyl urea receptor; CMD1O; FLJ36852; membrane receptor protein; si:dkey-183c2.3; Sulfonylurea receptor 2; sulfonylurea receptor subunit 2; sulfonylurea-binding protein 2; sulphonylurea receptor 2; sulphonylurea receptor 2A; sulphonylurea receptor 2B; SUR2; SUR2A; SUR2B
Gene Symbols ABCC9
Host Species Mouse
Immunogen Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A.
Purification Method Protein G
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10060, 20928, 25560
Target Species Human, Mouse, Rat
Content And Storage 4°C
Product Type Antibody
Form Liquid
Isotype IgG2a
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.