Invitrogen™ SUR2A Monoclonal Antibody (N319A/14), APC

Mouse Monoclonal Antibody

Supplier:  Invitrogen™ MA545607

Catalog No. PIMA545607

Description

1 μg/mL of MA5-45607 was sufficient for detection of SUR2A in 20 μg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody. Detects approximately 120kDa. Does not cross-react with SUR2B. This antibody was formerly sold as clone S319A-14.

Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell.

Specifications

• Antigen: SUR2A
• Classification: Monoclonal
• Concentration: 1 mg/mL
• Formulation: 2.48mM MES, 95.64mM phosphate with 0.5M EDTA and no preservative; pH 7.4
• Gene Accession No.: O60706, P70170, Q63563
• Gene Symbols: ABCC9
• Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG2a

• Applications: Immunohistochemistry, Western Blot, Immunocytochemistry
• Clone: N319A/14
• Conjugate: APC
• Gene: ABCC9
• Gene Alias: ABC37; ABCC9; AI414027; AI449286; ATFB12; ATP binding cassette subfamily C member 9; ATP-binding cassette sub-family C member 9; ATP-binding cassette transporter sub-family C member 9; ATP-binding cassette, subfamily C (CFTR/MRP), member 9; ATP-binding cassette, sub-family C (CFTR/MRP), member 9; CANTU; cardiac ventricle sulfonyl urea receptor; CMD1O; FLJ36852; membrane receptor protein; si:dkey-183c2.3; Sulfonylurea receptor 2; sulfonylurea receptor subunit 2; sulfonylurea-binding protein 2; sulphonylurea receptor 2; sulphonylurea receptor 2A; sulphonylurea receptor 2B; SUR2; SUR2A; SUR2B
• Host Species: Mouse
• Purification Method: Protein G
• Regulatory Status: RUO
• Gene ID (Entrez): 10060, 20928, 25560
• Content And Storage: 4°C
• Form: Liquid