Invitrogen™ SUR2A Monoclonal Antibody (N319A/14)

Catalog No.	Quantity
PIMA527637	100 μg

Catalog No. PIMA527637

Supplier: Invitrogen™ MA527637

Description

Mouse Monoclonal Antibody

1 μg/mL of MA5-27637 was sufficient for detection of SUR2A in 20 μg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody. Detects approximately 120kDa. Does not cross-react with SUR2B. This antibody was formerly sold as clone S319A-14.

Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell.

Specifications

• Antigen: SUR2A
• Applications: Immunohistochemistry (PFA fixed), Western Blot, Immunocytochemistry
• Classification: Monoclonal
• Clone: N319A/14
• Concentration: 1 mg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol and 0.1% sodium azide; pH 7.4
• Gene: ABCC9
• Gene Accession No.: O60706, P70170, Q63563
• Gene Alias: ABC37; ABCC9; AI414027; AI449286; ATFB12; ATP binding cassette subfamily C member 9; ATP-binding cassette sub-family C member 9; ATP-binding cassette transporter sub-family C member 9; ATP-binding cassette, subfamily C (CFTR/MRP), member 9; ATP-binding cassette, sub-family C (CFTR/MRP), member 9; CANTU; cardiac ventricle sulfonyl urea receptor; CMD1O; FLJ36852; membrane receptor protein; si:dkey-183c2.3; Sulfonylurea receptor 2; sulfonylurea receptor subunit 2; sulfonylurea-binding protein 2; sulphonylurea receptor 2; sulphonylurea receptor 2A; sulphonylurea receptor 2B; SUR2; SUR2A; SUR2B
• Gene Symbols: ABCC9
• Host Species: Mouse
• Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A.
• Purification Method: Protein G
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10060, 20928, 25560
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a