Invitrogen™ TAP1 Polyclonal Antibody

Catalog No.	Quantity
PIPA580094	100 μg

Catalog No. PIPA580094 Supplier Invitrogen™ Supplier No. PA580094

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, HUT whole cell, SW620 whole cell. IHC: human intestinal cancer tissue.

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease.

Specifications

• Antigen: TAP1
• Applications: Immunohistochemistry (Paraffin), Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene: TAP1
• Gene Accession No.: Q03518
• Gene Alias: ABC transporter, MHC 1; ABC transporter, MHC, 1; ABC17; ABCB2; ABP-278; ABP-280; ABP-280 homolog; Antigen peptide transporter 1; AOI; APT1; ATP dependent transport protein family member; ATP-binding cassette sub-family B member 2; ATP-binding cassette transporter, major histocompatibility complex, 1; ATP-binding cassette, sub-family B (MDR/TAP), member 2; beta-filamin; Cim; D6S114E; DAAP-57C1.5; FH1; filamin homolog 1; filamin-3; filamin-B; FLJ26666; FLJ41500; FLN1L; FLN-B; Ham1; Ham-1; Histocompatibility antigen modifier 1; LRS1; MTP1; Peptide supply factor 1; peptide transporter involved in antigen processing 1; Peptide transporter PSF1; peptide transporter TAP1; PSF1; PSF-1; Really interesting new gene 4 protein; RING4; SCT; TABP; TAP; tap i; TAP1; Tap-1; TAP1*0102N; TAP1N; Tap2; thyroid autoantigen; transporter 1 ABC (ATP binding cassette); transporter 1 ATP-binding cassette sub-family B; transporter 1, ABC (ATP binding cassette); transporter 1, ATP binding cassette subfamily B member; transporter 1, ATP-binding cassette, sub-family B (MDR/TAP); transporter associated with antigen processing; transporter associated with antigen processing 1; transporter, ABC, MHC, 1; transporter, ATP-binding cassette, major histocompatibility complex, 1; Y3
• Gene Symbols: TAP1
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human TAP1 (438-471aa RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN).
• Purification Method: Antigen affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6890
• Target Species: Human
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov