Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ TAP1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA580094
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA580094 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA580094 Supplier Invitrogen™ Supplier No. PA580094
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, HUT whole cell, SW620 whole cell. IHC: human intestinal cancer tissue.

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TAP1
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene TAP1
Gene Accession No. Q03518
Gene Alias ABC transporter, MHC 1; ABC transporter, MHC, 1; ABC17; ABCB2; ABP-278; ABP-280; ABP-280 homolog; Antigen peptide transporter 1; AOI; APT1; ATP dependent transport protein family member; ATP-binding cassette sub-family B member 2; ATP-binding cassette transporter, major histocompatibility complex, 1; ATP-binding cassette, sub-family B (MDR/TAP), member 2; beta-filamin; Cim; D6S114E; DAAP-57C1.5; FH1; filamin homolog 1; filamin-3; filamin-B; FLJ26666; FLJ41500; FLN1L; FLN-B; Ham1; Ham-1; Histocompatibility antigen modifier 1; LRS1; MTP1; Peptide supply factor 1; peptide transporter involved in antigen processing 1; Peptide transporter PSF1; peptide transporter TAP1; PSF1; PSF-1; Really interesting new gene 4 protein; RING4; SCT; TABP; TAP; tap i; TAP1; Tap-1; TAP1*0102N; TAP1N; Tap2; thyroid autoantigen; transporter 1 ABC (ATP binding cassette); transporter 1 ATP-binding cassette sub-family B; transporter 1, ABC (ATP binding cassette); transporter 1, ATP binding cassette subfamily B member; transporter 1, ATP-binding cassette, sub-family B (MDR/TAP); transporter associated with antigen processing; transporter associated with antigen processing 1; transporter, ABC, MHC, 1; transporter, ATP-binding cassette, major histocompatibility complex, 1; Y3
Gene Symbols TAP1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human TAP1 (438-471aa RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6890
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.