Invitrogen™ TAT Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA580097

Catalog No. PIPA580097

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat spleen tissue, mouse liver tissue, A549 whole cell.

TAT is a mitochondrial protein tyrosine aminotransferase which is present in the liver and catalyzes the conversion of L-tyrosine into p-hydroxyphenylpyruvate.

Specifications

• Antigen: TAT
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: TAT
• Gene Alias: 2.6.1.5; L-tyrosine:2-oxoglutarate aminotransferase; Tat; testis tissue sperm-binding protein Li 34a; tyrosine aminotransferase; tyrosine aminotransferase, cytosolic; tyrosine transaminase
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 234724, 24813, 6898
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P04694, P17735, Q8QZR1
• Gene Symbols: TAT
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ATTY (169-208aa FSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG