Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Val-Gln-Ile-Val-Tyr-Lys-Pro-Val-Asp-Leu-Ser-Lys-Val-Thr-Ser-Lys-Cys-Gly-Ser-Leu-Gly-Asn-Ile-His-His-Lys-Pro-Gly-Gly-Gly-Gln-OH (trifluoroacetate salt) 5MG
SDP

Supplier:  CPC Scientific TAUP005B

Encompass

TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer?s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus (see figure below). Tau Peptide (306-336) is a 31-amino acid long peptide derived from the Repeat 3 domain.ONE-LETTER SEQUENCE: VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQMOLECULAR FORMULA: C143H236N42O42S1MOLECULAR WEIGHT:3247.77STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [330456-26-3], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: Buee, L. et al. Brain Res Rev 33 95 (2000). Trinczek, B. et al. Mol Biol Cell 6, 1887 (1995).

Catalog No. 50-211-0553


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.