Learn More
CPC Scientific H-Val-Gln-Ile-Val-Tyr-Lys-Pro-Val-Asp-Leu-Ser-Lys-Val-Thr-Ser-Lys-Cys-Gly-Ser-Leu-Gly-Asn-Ile-His-His-Lys-Pro-Gly-Gly-Gly-Gln-OH (trifluoroacetate salt) 5MG

Supplier: CPC Scientific TAUP005B

TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer?s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus (see figure below). Tau Peptide (306-336) is a 31-amino acid long peptide derived from the Repeat 3 domain.ONE-LETTER SEQUENCE: VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQMOLECULAR FORMULA: C143H236N42O42S1MOLECULAR WEIGHT:3247.77STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [330456-26-3], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: Buee, L. et al. Brain Res Rev 33 95 (2000). Trinczek, B. et al. Mol Biol Cell 6, 1887 (1995).
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.