Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TBLR1 Polyclonal Antibody, Invitrogen™

Catalog No. PIPA129834
Change view
Click to view available options
Quantity:
100 μg
Catalog No. Quantity
PIPA129834 100 μg
1 options

Catalog No. PIPA129834

Supplier: Thermo Scientific PA129834

Rabbit Polyclonal Antibody

PA1-29834 detects TBLR1 from rat, mouse, human samples.

Chromatin organization plays a fundamental role in regulating transcription in eukaryotic cells. The nuclear receptor corepressor (N-CoR) and silencing mediator of retinoid and thyroid hormone receptors (SMRT) play a role in diverse transcriptional repression pathways. N-CoR and SMRT each exist in large protein complexes, and are thought to mediate repression, at least in part, by their ability to recruit histone deacetylases to generate repressive chromatin. HDAC3 is the main HDAC that associates with N-CoR and SMRT complexes, and its presence is thought to be essential for repression. TBLR1 is a WD-40 repeat protein that also associates with N-CoR and SMRT complexes. Although TBLR1 is thought to be a core component of both the N-CoR and SMRT complexes, its role in these complexes remains to be elucidated.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TBLR1
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 0.5 mg/mL
Conjugate Unconjugated
Formulation PBS with 0.2% gelatin and 0.05% sodium azide
Gene TBL1XR1
Gene Accession No. Q9BZK7
Gene Alias 8030499H02Rik; A630076E03Rik; AW539987; C21; C230089I12Rik; DC42; F-box-like/WD repeat protein TBL1XR1; F-box-like/WD repeat-containing protein TBL1XR1; FLJ12894; Ira1; MRD41; nuclear receptor co-repressor/HDAC3 complex subunit; nuclear receptor corepressor/HDAC3 complex subunit TBLR1; RGD1560053; TBL1-related protein 1; TBL1XR1; TBLR1; transducin (beta)-like 1 X-linked receptor 1; transducin (beta)-like 1X-linked receptor 1; transducin beta-like 1X-related protein 1
Gene Symbols TBL1XR1
Host Species Rabbit
Immunogen synthetic peptide WPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWT, corresponding to amino acids 200-250 of Human TBLR1.
Purification Method Protein G
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79718
Target Species Human
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Product Type Antibody
Form Liquid
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.