Novus Biologicals™ TBP like protein TLP Recombinant Protein Antigen

Catalog No.	Quantity
NBP257783PE	100 μL

Catalog No. NBP257783PE Supplier Novus Biologicals™ Supplier No. NBP257783PEP

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TBP like protein TLP. Source: E.coli Amino Acid Sequence: CNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEI The TBP like protein TLP Recombinant Protein Antigen is derived from E. coli. The TBP like protein TLP Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 9519
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: TBP like protein TLP Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
• Formulation: PBS and 1M Urea, pH 7.4
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: 21 kDa TBP-like protein, STUD21-kDA TBP-like protein, TATA box binding protein-related factor 2, TATA box-binding protein-like protein 1, TATA box-binding protein-related factor 2, TBP-like 1, TBP-like factor, TBP-like protein 1, TBP-related factor 2, TBP
• Gene Symbol: TBPL1
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53312. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For research use only.