Invitrogen™ TFPI2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595444

Catalog No. PIPA595444

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: mouse spleen tissue, HELA whole cell, human placenta tissue, MCF-7 whole cell. IHC: human placenta tissue. Flow: U87 cell, A549 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

TFPI2 may play a role in the regulation of plasmin-mediated matrix remodeling. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 has no effect on thrombin.

Specifications

• Antigen: TFPI2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: TFPI2
• Gene Alias: AV000670; Placental protein 5; PP5; PP5/TFPI-2; PP5FLJ21164; REF1; REF-1; retinal pigment epithelium cell factor 1; TFPI2; TFPI-2; TFPI-2REF1; Tissue factor pathway inhibitor 2
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 21789, 7980
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: O35536, P48307
• Gene Symbols: TFPI2
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TFPI2 (70-105aa EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody
• Isotype: IgG