Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPC Scientific H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro-OH (trifluoroacetate salt) 1MG
Supplier: CPC Scientific PTHP017A
This is a tuberoinfundibular neuropeptide and parathyroid hormone 2(PTH 2)-receptor agonist from hypothalmus. Synthetic TIP39 activates human and rat PTH2 receptors. ONE-LETTER SEQUENCE: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAPMOLECULAR FORMULA: C202H325N61O54S1MOLECULAR WEIGHT:4504.3STORAGE CONDITIONS: -20 5CRESEARCH AREA: OsteoporosisREFERENCES: Usdin, TB. et al. Nat. Am. 2, 941 (1999) Piserchio, A. et al. J. Biol. Chem. 275, 27284 (2000).
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?