Abnova™ TNFRSF21 Recombinant Protein

Catalog No.	Quantity
89-012-572	25 μg
89-012-571	10 μg

Catalog No. 89-012-572 Supplier Abnova™ Supplier No. H00027242P0125

Description

Human TNFRSF21 full-length ORF ( AAH05192.1, 1 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction of TNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation. (provided by RefSeq)

• Molecular weight: 39.38
• Preparation method: in vitro wheat germ expression system
• Purification: Glutathione Sepharose 4 Fast Flow
• Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8 in the elution buffer
• Quality Control Testing:12.5% SDS-PAGE stained with Coomassie Blue

Best use within three months from the date of receipt of this protein

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

• Accession Number: AAH05192.1
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• Gene ID (Entrez): 27242
• Molecular Weight (g/mol): 39.38
• Name: TNFRSF21 (Human) Recombinant Protein (P01)
• pH Range: 8
• Preparation Method: In vitro wheat germ expression system
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Source: Wheat Germ (in vitro)
• Immunogen: MQFNFELSFKYVLYSSYSWLKLDHTIADCMVFTWTPCRMLDYLYSSYANMLWAGEMKSSSHQDLLFKWLDNWATKELELHLLGFELFWNTLLHFGKSKSSASGALSIENLPSFALKDVLFFIYT
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: BM-018/DR6/MGC31965
• Common Name: TNFRSF21
• Gene Symbol: TNFRSF21
• Cross Reactivity: Human
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Form: Solution