Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502110592

CPC Scientific H-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2 (trifluoroacetate salt) 0.5MG
SDP

Supplier:  CPC Scientific UROC004A

Encompass

A highly selective ligand for the CRF-II receptor, this peptide features an amino acid sequence of the urocortin III peptide that corresponds to amino acids three to 40 of stresscopin (human).ONE-LETTER SEQUENCE: FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2MOLECULAR FORMULA: C185H307N53O50S2MOLECULAR WEIGHT:4137.93STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [357952-09-1], SYNONYMS: Stresscopin (3-40) (human)RESEARCH AREA: NeuropeptidesREFERENCES: K.Lewis et al., Proc. Natl. Acad. Sci. USA , 98, 7570 (2001)

Catalog No. 50-211-0592


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.