Learn More
CPC Scientific H-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2 (trifluoroacetate salt) 0.5MG

Supplier: CPC Scientific UROC004A

A highly selective ligand for the CRF-II receptor, this peptide features an amino acid sequence of the urocortin III peptide that corresponds to amino acids three to 40 of stresscopin (human).ONE-LETTER SEQUENCE: FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2MOLECULAR FORMULA: C185H307N53O50S2MOLECULAR WEIGHT:4137.93STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [357952-09-1], SYNONYMS: Stresscopin (3-40) (human)RESEARCH AREA: NeuropeptidesREFERENCES: K.Lewis et al., Proc. Natl. Acad. Sci. USA , 98, 7570 (2001)
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.