Learn More
CPC Scientific H-Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH (trifluoroacetate salt) 1MG

Supplier: CPC Scientific NATR004B
Urodilatin (95-126) originally extracted from human urine that corresponds to the family of natriuretic-vasorelaxant peptides found earlier in heart atria. Infusion of this peptide is found to represent a concept for the treatment of therapy-resistant acute renal failure after liver transplantion. The use of NATR-004 is protected by patents. ONE-LETTER SEQUENCE: TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (C11&C27 bridge)MOLECULAR FORMULA: C145H234N52O44S3MOLECULAR WEIGHT:3506STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [115966-23-9], RESEARCH AREA: CardiovascularREFERENCES: P. Schultz-Knappe et al., Klin. Wochenschr., 66, 752 (1988)
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.