Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109854

CPC Scientific H-Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific NATR004B

Encompass

Urodilatin (95-126) originally extracted from human urine that corresponds to the family of natriuretic-vasorelaxant peptides found earlier in heart atria. Infusion of this peptide is found to represent a concept for the treatment of therapy-resistant acute renal failure after liver transplantion. The use of NATR-004 is protected by patents. ONE-LETTER SEQUENCE: TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (C11&C27 bridge)MOLECULAR FORMULA: C145H234N52O44S3MOLECULAR WEIGHT:3506STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [115966-23-9], RESEARCH AREA: CardiovascularREFERENCES: P. Schultz-Knappe et al., Klin. Wochenschr., 66, 752 (1988)

Catalog No. 50-210-9854


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.