Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502110599

CPC Scientific H-Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2 (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific UROT001B

Encompass

Homologous sequence-containing peptide with hypothalamic corticotropin-releasing factor (CRF) and the frog skin peptide sauvagine.ONE-LETTER SEQUENCE: NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2MOLECULAR FORMULA: C210H340N62O67S2MOLECULAR WEIGHT:4869.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [83930-33-0], RESEARCH AREA: NeuropeptidesREFERENCES: K. Lederis et al., Science, 218, 162 (1982)

Catalog No. 50-211-0599


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.