Learn More
CPC Scientific H-Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2 (trifluoroacetate salt) 1MG

Supplier: CPC Scientific UROT001B

Homologous sequence-containing peptide with hypothalamic corticotropin-releasing factor (CRF) and the frog skin peptide sauvagine.ONE-LETTER SEQUENCE: NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2MOLECULAR FORMULA: C210H340N62O67S2MOLECULAR WEIGHT:4869.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [83930-33-0], RESEARCH AREA: NeuropeptidesREFERENCES: K. Lederis et al., Science, 218, 162 (1982)
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.