Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502110613

CPC Scientific H-His-Ser-Asp-Ala-Leu-Phe-Thr-Asp-Thr-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Met-Lys-Lys-Tyr-Leu-Asn-Ser-Val-Leu-Asn-NH2 (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific VIP005B

Encompass

Vasoactive intestinal peptide derived from guinea pig. Though it differs from other mammalian species by four amino acids (positions 5, 9, 19, 26), this substitution does not have any impact on its biological activity.ONE-LETTER SEQUENCE: HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2MOLECULAR FORMULA: C147H239N43O42S2MOLECULAR WEIGHT:3344.91STORAGE CONDITIONS: -20 5CRESEARCH AREA: GastrointestinalREFERENCES: B.H. Du et al., BBRC, 128, 1093 (1985)

Catalog No. 50-211-0613


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.