Novus Biologicals™ VPS35L Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C16orf62. Source: E.coli Amino Acid Sequence: FDFLLTFKQIHGDTVQNQLVVQGVELPSYLPLYPPAMDWIFQCISYHAPEALLTEMMERCKKLGNNALLLNSVMSAFRAEFIATRSMDFIGM The C16orf62 Recombinant Protein Antigen is derived from E. coli. The C16orf62 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 57020
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: C16orf62 Recombinant Protein Antigen
• Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: chromosome 16 open reading frame 62, DKFZp313M0539, DKFZp434B0212, esophageal cancer associated protein, Esophageal cancer-associated protein, FLJ21040, hypothetical protein LOC57020, MGC16824
• Gene Symbol: C16ORF62
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51860. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
• Target Gene: VPS35L

For Research Use Only