Biochemical Reagents
American Radiolabeled Chemicals Inc DOCO 14C COA 10UC
Docosahexaenoyl-4,7,10,13,16,19-14C Coenzyme A 10uCi in 0.01N HCl (pH 5.2) 0.1 mCi/ml, 50-60 mCi/mmol, M.W. 1128.43, Shipped in Dry Ice, Exclusive
Bachem TRAP-6 Trifluoroacetate
TRAP-6 Trifluoroacetate, H-Ser-Phe-Leu-Leu-Arg-Asn-OH, 141136-83-6, C34H56N10O9, Mr 748.88, 5mg. PAR-1 (1-6) (human), Thrombin Receptor Activator Peptide 6, Proteinase Activated Receptor 1 (1-6) (human), Thrombin Receptor (1-6) (human), Coagulation Factor II Receptor (1-6) (human), SFLLRN. SFLLRN corresponds to residues 42-47 of the thrombin receptor. The hexapeptide acts as a thrombin receptor activator. It caused half-maximal platelet aggregation at approx. 0.8 uM and was 5 times more potent than the parent peptide H-8105. In addition, SFLLRN is effective in causing tyrosine phosphorylation, inhibition of cAMP formation, and an increase in cytosolic Ca2+.
Vector Laboratories Wheat Germ Agglutinin (WGA), Fluorescein (FL-1021)
The receptor sugar for WGA is N-acetylglucosamine, with preferential binding to dimers and trimers of this sugar. WGA can bind oligosaccharides containing terminal N-acetylglucosamine or chitobiose, structures which are common to many serum and membrane glycoproteins. Bacterial cell wall peptidoglycans, chitin, cartilage glycosaminoglycans, and glycolipids can also bind WGA. Native WGA has also been reported to interact with some glycoproteins via sialic acid residues (see succinylated WGA).Fluorescein labeled WGA has an appropriate number of fluorochromes bound to provide the optimum staining characteristics for this lectin. This conjugate is supplied essentially free of unconjugated fluorochromes. The excitation maximum is at 495 nm and the emission maximum is at 515 nm.
Chem-Impex International, Inc. Boc-4-nitro-L-phenylalanine | 33305-77-0 | MFCD00038128 | 1G
Boc-4-nitro-L-phenylalanine, 33305-77-0, MFCD00038128, 1G
CPC Scientific H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 1MG
A 28 amino acid peptide synthesized in the central nervous system and gastrointestinal tract. It belongs to the secretin glucagon-CRF family and is widely distributed in the central and peripheral nervous systems. In acting as both a neurotransmitter and hormone that has powerful hypotensive and vasodilatory effects, this peptide plays a wide role in a range of biological activities, including vaso- and bronchodilation, smooth muscle relaxation, and stimulation of secretin. When paired with the adrenegic drug phentolamine and injected, this peptide is expected to provide a new and effective solution for patients suffering from erectile dysfunction.SEQUENCE: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2ONE-LETTER SEQUENCE: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2MOLECULAR FORMULA: C147H238N44O42S1MOLECULAR WEIGHT: 3325.80STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [40077-57-4]SYNONYMS: Aviptadil, VIP (
Accela Chembio Inc D-proline | 100g | 344-25-2 | MFCD00064317 | 98% | Shelf Life: 1800 Days | Moisture Sensitive
D-proline | 100g | 344-25-2 | MFCD00064317 | 98% | Shelf Life: 1800 Days | Moisture Sensitive
Chem-Impex International, Inc. Na-Fmoc-Ne-Boc-L-lysine | 71989-26-9 | MFCD00037138 | 250G
Na-Fmoc-Ne-Boc-L-lysine, 71989-26-9, MFCD00037138, 250G
CPC Scientific H-Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 1MG
Multifunctional Peptide in NeuroendocrinologySEQUENCE: H-Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2ONE-LETTER SEQUENCE: SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2MOLECULAR FORMULA: C160H252N56O42S1MOLECULAR WEIGHT: 3664.2STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [215510-22-8]SYNONYMS: PrRP31 (human), Preprolactin (23-53) (human), Prolactin-Releasing Peptide (1-31) (human)RESEARCH AREA: HormonalREFERENCES:Engstr?m, et al. J. Pharmacol. Exp. Ther. 305, 825 (2003) S. Hinuma, et al. Nature, 393, 272 (1998) F. Satoh, et. al. J. Pharmacol.,129, 1787 (2000)
SKU(s): PROL-001A, PROL-001B
Chemscene ChemScene | 4-Chloro-2-butenoic acid | 250MG | CS-0139553 | 0.97 | 16197-90-3| MFCD19228094 | 120.53
ChemScene | 4-Chloro-2-butenoic acid | 250MG | CS-0139553 | 0.97 | 16197-90-3| MFCD19228094 | 120.53
Chemscene ChemScene | 5-Bromo-1H-imidazole-2-carboxylic acid | 50MG | CS-0018715 | 0.98 | 1260753-02-3| MFCD09842486 | 190.98
ChemScene | 5-Bromo-1H-imidazole-2-carboxylic acid | 50MG | CS-0018715 | 0.98 | 1260753-02-3| MFCD09842486 | 190.98
![Chemscene ChemScene | tert-Butyl 2,7-diazaspiro[4.5]decane-7-carboxylate | 250MG | CS-D0113 | 0.97 | 236406-61-4| MFCD07779071 | 240.35](https://assets.fishersci.com/TFS-Assets/CCG/product-images/CS-D0113.JPG-250.jpg)
Chemscene ChemScene | tert-Butyl 2,7-diazaspiro[4.5]decane-7-carboxylate | 250MG | CS-D0113 | 0.97 | 236406-61-4| MFCD07779071 | 240.35
ChemScene | tert-Butyl 2,7-diazaspiro[4.5]decane-7-carboxylate | 250MG | CS-D0113 | 0.97 | 236406-61-4| MFCD07779071 | 240.35
STA PHARMACEUTICAL US LLC Fmoc-L-hArg(diEt)-OH HCl | 10 g | CAS 1864003-26-8 | MDL MFCD18782840
Fmoc-L-hArg(diEt)-OH HCl is a Amino Acid reagent (Subcategory: Homo-natural AA) sold by WuXi TIDES. Offered in 10 g. Store at 4 °C. SDS available for reference.
Specifications
- CAS: 1864003-26-8
- MDL: MFCD18782840
- InChIKey: LSZCKIIJZGKYEN-BQAIUKQQSA-N
- Molecular Weight: 503.04
- Molecular Formula: C26H35ClN4O4
- Purity: ≥95%
- Container Type: 60 mL HDPE
- Pack Size: 10 g
- Net Weight: 10 g
- Gross Weight: 25 g
- Commodity Code: 29252900
- Country Of Origin: China
- IUPAC: (E)-N2-(((9H-fluoren-9-yl)methoxy)carbonyl)-N6-(N,N'-diethylcarbamimidoyl)-L-lysine hydrochloride
- SMILES: CC/N=C(NCC)/NCCCC[C@@H](C(O)=O)NC(OCC1C2=C(C3=C1C=CC=C3)C=CC=C2)=O.Cl
Medchemexpress LLC Oligopeptide-24 (CG-EDP3) | 1018685-16-9 | 99.6% | 1271.38 | 5 MG
Oligopeptide-24 (CG-EDP3) is a 13 amino acid biomimetic peptide designed for skin repair. It upregulates the expression of elastin and hyaluronic acid while increasing fibroblast activity. This peptide can be utilized in cosmetic formulations as an anti-wrinkle and firming agent, and it has the potential to boost endogenous growth factor concentration in the skin significantly.
- Upregulates elastin and hyaluronic acid expression
- Increases fibroblast activity
- Functions as an anti-wrinkle and firming agent
- Increases endogenous growth factor concentration in skin
- Can be accurately quantified in cosmetic products
American Radiolabeled Chemicals Inc N BOC PRO 3H 1LC
N-t-BOC-L-Proline-3,4-3H 1mCi in ethanol, 1 mCi/ml, 40-60 Ci/mmol, M.W. 215.25, Exclusive