Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

2,401 – 2,415 of 119,753 results

2,401

Novus Biologicals™ Recombinant Human HSPB8/HSP22 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,402

Novus Biologicals™ Recombinant Human AP3S1 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,403

Novus Biologicals™ Recombinant Human TUG His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,404

Novus Biologicals™ Recombinant Human AMTN His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,405

Novus Biologicals™ UAP56 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	UAP56
Molecular Weight (g/mol)	51.1kDa
Gene ID (Entrez)	7919
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol 0.1M NaCl, 1mM DTT
Immunogen	BAT1, 1-428 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

2,406

Novus Biologicals™ Recombinant Human MKK6/MEK6 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Purity or Quality Grade	>85%, by SDS-PAGE
Conjugate	Unconjugated
Gene Alias	MAP kinase kinase 6, MAPK/ERK kinase 6, MAPKK6dual specificity mitogen-activated protein kinase kinase 6, MEK6MAPKK 6, mitogen-activated protein kinase kinase 6, MKK6MEK 6, PRKMK6protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6), SAPKK3EC 2.7.12.2
Common Name	MKK6/MEK6
Molecular Weight (g/mol)	TMW: 32kDa
Gene ID (Entrez)	5608
Formulation	20mM Tris-HCl (pH8.0) containing 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

2,407

Novus Biologicals™ Recombinant Human FRA2 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Purity or Quality Grade	>85%, by SDS-PAGE
Conjugate	Unconjugated
Gene Alias	FOS-like antigen 2, fos-related antigen 2, FRA-2, FRA2FLJ23306
Common Name	FRA2
Molecular Weight (g/mol)	TMW: 37.6kDa
Gene ID (Entrez)	2355
Formulation	20mM Tris-HCl(pH 8.0) containing 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

2,408

Novus Biologicals™ ARF6 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	ARF6
Molecular Weight (g/mol)	22.2kDa
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1.0mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Recombinant human ARF6 protein, fused to His-tag at N-terminus, expressed in E. coli
Accession Number	NP_001654
Regulatory Status	RUO
Purification Method	Protein
Gene ID (Entrez)	382
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 2mM DTT, 20% glycerol, 0.2mM PMSF
Immunogen	ARF6, 1-175aa, Human, His tag, E. coli (NP_001654).
Recombinant	Recombinant

2,409

Novus Biologicals™ Recombinant E. coli Tryptophanase His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Common Name	Tryptophanase
Molecular Weight (g/mol)	TMW: 55.2kDa
Formulation	Phosphate buffered saline (pH7.4) containing 10% glycerol, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

2,410

Novus Biologicals™ Recombinant Human NKX3.1 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability

2,411

Novus Biologicals™ Recombinant Human NRBF2 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,412

Novus Biologicals™ Recombinant Human DC8 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability

2,413

Novus Biologicals™ Recombinant Human p70 S6 Kinase/S6K Isoform a Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>85%, by SDS-PAGE
Molecular Weight (g/mol)	60.2 kDa
Gene ID (Entrez)	6198
Formulation	50mM Tris-HCl (pH 7.5) containing 30% glycerol, 0.5M NaCl, 2mM DTT, 0.1mM PMSF
Gene Symbol	RPS6KB1
Endotoxin Concentration	< 1.0 EU per 1μg of protein (determined by LAL method)
Storage Requirements	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25 mg/ml
Cross Reactivity	p70 S6 Kinase/S6K
For Use With (Application)	SDS-PAGE
Species	Human
Source	Baculovirus

2,414

Novus Biologicals™ Recombinant Human ING2 Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>90%, by SDS-PAGE
Molecular Weight (g/mol)	35.2 kDa
Gene ID (Entrez)	3622
Formulation	20mM MES (pH5.0) containing 20% Glycerol, 0.1M NaCl
Gene Symbol	ING2
Storage Requirements	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Concentration	1 mg/ml
Cross Reactivity	ING2
For Use With (Application)	SDS-PAGE
Species	Human
Source	E. coli

2,415

Novus Biologicals™ Recombinant Human PICK1 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>85%, by SDS-PAGE
Conjugate	Unconjugated
Gene Alias	alpha binding protein, dJ1039K5, MGC15204, PICK, PRKCA-binding protein, PRKCABPprotein interacting with PRKCA, Protein interacting with C kinase 1, protein interacting with PRKCA 1, Protein kinase C-alpha-binding protein
Common Name	PICK1
Molecular Weight (g/mol)	TMW: 49kDa
Gene ID (Entrez)	9463
Formulation	Phosphate buffered saline (pH7.4) containing 30% glycerol, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

Prev
1
...
159
160
161
162
...
7,984
Next

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ Recombinant Human HSPB8/HSP22 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human AP3S1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human TUG His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human AMTN His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ UAP56 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human MKK6/MEK6 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human FRA2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ ARF6 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant E. coli Tryptophanase His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human NKX3.1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human NRBF2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human DC8 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human p70 S6 Kinase/S6K Isoform a Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human ING2 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human PICK1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human HSPB8/HSP22 His Protein

Novus Biologicals™ Recombinant Human AP3S1 His Protein

Novus Biologicals™ Recombinant Human TUG His Protein

Novus Biologicals™ Recombinant Human AMTN His Protein

Novus Biologicals™ UAP56 Protein

Novus Biologicals™ Recombinant Human MKK6/MEK6 His Protein

Novus Biologicals™ Recombinant Human FRA2 His Protein

Novus Biologicals™ ARF6 Protein

Novus Biologicals™ Recombinant E. coli Tryptophanase His Protein

Novus Biologicals™ Recombinant Human NKX3.1 His Protein

Novus Biologicals™ Recombinant Human NRBF2 His Protein

Novus Biologicals™ Recombinant Human DC8 His Protein

Novus Biologicals™ Recombinant Human p70 S6 Kinase/S6K Isoform a Protein

Novus Biologicals™ Recombinant Human ING2 Protein

Novus Biologicals™ Recombinant Human PICK1 His Protein