Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

3,016 – 3,030 of 115,734 results

3,016

R&D Systems™ Recombinant Human IFN-alpha-1a Protein

Pricing & Availability
Specifications

Accession Number	P01562.1
Purity or Quality Grade	>95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie™ Blue Staining.
Conjugate	Unconjugated
Molecular Weight (g/mol)	MolecularWeight-observed: 17-21 kDa, under reducing conditions., MolecularWeight-theroretical: 19 kDa
Gene ID (Entrez)	3439
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Reconstitution	Reconstitute at 100 μg/mL in PBS.
Endotoxin Concentration	<0.10 EU / 1 μg of the protein by the LAL method.
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 3 months, -20°C to -70°C under sterile conditions after reconstitution.
For Use With (Application)	Bioactivity
Protein	IFN-alpha 1
Source	Human embryonic kidney cell, HEK293-derived human IFN-alpha 1 protein Cys24-Glu189

3,017

Gibco™ Human CCL18 (MIP-4) Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>98% by SDS-PAGE
Conjugate	Unconjugated
Form	Lyophilized
Molecular Weight (g/mol)	7.8 kDa
Common Name	PARC
Gene Symbol	CCL18
Endotoxin Concentration	<0.1 ng/μg
Storage Requirements	-20°C
Sequence	Human CCL18 recombinant protein contains 68 amino acids
Expression System	E. coli
For Use With (Application)	Bioactivity
Name	Human CCL18 (MIP-4)
Accession Number	P55774
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	Alternative macrophage activation-associated CC chemokine 1; AMAC1; AMAC-1; CC chemokine ligand 18; CC chemokine PARC; C-C motif chemokine 18; C-C motif chemokine ligand 18; CCL18; CCL18(1-68); CCL18(3-69); CCL18(4-69); chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated); chemokine (C-C), dendritic; CKb7; CUL9; CUL-9; cullin 9; cullin-9; DCCK1; DC-CK1; dendritic cell chemokine 1; H7AP1; H-MIP-4; KIAA0708; Macrophage inflammatory protein 4; MIP4; MIP-4; p53-associated parkin-like cytoplasmic protein; PARC; parkin-like cytoplasmic p53 binding protein; pulmonary and activation-regulated chemokine; SCYA18; small inducible cytokine A18; small inducible cytokine subfamily A (Cys-Cys), member 18, pulmonary and activation-regulated; small-inducible cytokine A18; UbcH7-associated protein 1
Product Type	Protein
Gene ID (Entrez)	6362
Formulation	Protein with no preservative
Recombinant	Recombinant

3,018

R&D Systems™ Recombinant Human IL-18 R alpha/IL-1 R5 Fc Avi-tag

Biotinylated

Pricing & Availability

3,019

Invitrogen™ Human IL-1 beta (ELISA Standard) Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Lyophilized
Common Name	IL-1 beta
Gene Symbol	IL1B
Storage Requirements	4°C
Sequence	Human IL-1 beta, amino acids Ala117-Ser260 (Accession # NM_000576)
Expression System	E. coli
For Use With (Application)	Neutralization,ELISA Standard
Name	Human IL-1 beta (ELISA Standard)
Accession Number	P01584
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	catabolin; cytokine; Hematopoietin 1 (H1); IFN beta inducing factor; il 1b; IL 1β; IL-1; IL1 B; IL-1 beta; IL-1 precursor; IL1B; IL-1B; IL1B1; IL1beta; IL-1beta; IL1-BETA; IL1F2; IL1β; ILN; Interleukin; interleukin 1 beta; Interleukin 1 beta precursor; interleukin 1, beta; interleukin 1, beta 1; interleukin 1-beta; interleukin1beta; Interleukin1 beta; interleukin-1 beta; interleukin-1 beta precursor; interleukin-1 beta precursor (AA -113 to 153); interleukin-1 beta proprotein; interleukin-1b; interleukin-1beta; interleukin-beta; LAF; lymphocyte proliferation-potentiating factor; Osteoclast activating factor (OAF); preinterleukin 1 beta; Pro interleukin 1 beta; prointerleukin-1 beta; pro-interleukin-1-beta
Product Type	Protein
Gene ID (Entrez)	3553
Formulation	Protein with no preservative
Recombinant	Recombinant

3,020

Novus Biologicals™ ECH1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	ECH1
Molecular Weight (g/mol)	34.4kDa
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 50mM NaCl
Immunogen	ECH1, 34-328aa. Sequence: MGSSHHHHHHSSGLVPRGSHMTGSSAQEAASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

3,021

Novus Biologicals™ Nanog Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

3,022

Novus Biologicals™ Recombinant Human Rab5a Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

3,023

R&D Systems™ Recombinant Mouse PDGF R alpha His-tag Protein

The Recombinant Mouse PDGF R alpha His-tag Protein is derived from NS0

Pricing & Availability

3,024

Novus Biologicals™ CDC26 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

3,025

R&D Systems™ Recombinant Human BST-2/Tetherin Protein

BST-2, also known as tetherin or CD317, is a type II transmembrane protein that is constitutively expressed in several cell types including T cells, B cells, monocytes and macrophages, as well as on several cancer cell lines including the B cell lineage in multiple myeloma

Pricing & Availability

3,026

R&D Systems™ Recombinant Human IL-17RC Isoform 3 Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Binding Activity

Pricing & Availability

3,027

R&D Systems™ Recombinant Human CEACAM-1/CD66a Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

3,028

Novus Biologicals™ Recombinant Human DC-LAMP His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	CD208 antigen, DC-LAMP, DCLAMPDC-lysosome-associated membrane glycoprotein, LAMP, LAMP-3, lysosomal-associated membrane protein 3DC LAMP, lysosome-associated membrane glycoprotein 3, Protein TSC403, TSC403CD208
Common Name	DC-LAMP
Molecular Weight (g/mol)	TMW: 38.8kDa
Gene ID (Entrez)	27074
Formulation	Phosphate buffered saline (pH 7.4) containing 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Source	Baculovirus
Recombinant	Recombinant

3,029

Novus Biologicals™ Recombinant Human CHCHD7 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	coiled-coil-helix-coiled-coil-helix domain containing 7, coiled-coil-helix-coiled-coil-helix domain-containing protein 7, FLJ40966, MGC2217
Common Name	CHCHD7
Molecular Weight (g/mol)	TMW: 13.9kDa
Gene ID (Entrez)	79145
Formulation	20mM Tris-HCl buffer (pH8.0) containing 10% glycerol, 0.1M NaCl
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

3,030

R&D Systems™ Recombinant Mouse Pentraxin 2/SAP His-tag Protein

Measured by its binding ability in a functional ELISA.

Pricing & Availability

Prev
1
...
200
201
202
203
...
7,716
Next

Welcome to fishersci.com

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ ECH1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Nanog Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Rab5a Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ CDC26 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human DC-LAMP His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human CHCHD7 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ ECH1 Protein

Novus Biologicals™ Nanog Protein

Novus Biologicals™ Recombinant Human Rab5a Protein

Novus Biologicals™ CDC26 Protein

Novus Biologicals™ Recombinant Human DC-LAMP His Protein

Novus Biologicals™ Recombinant Human CHCHD7 His Protein