Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ ECH1 Protein

Highly purified. Generating reliable and reproducible results.

Manufacturer:  Novus Biologicals™ NBP1483890.5MG

 View more versions of this product

Catalog No. NBP1483895


Add to cart

Description

Description

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 34-328 of Human ECH1 The Recombinant Human ECH1 Protein is derived from E. coli. The Recombinant Human ECH1 Protein has been validated for the following applications: SDS-Page.
Specifications

Specifications

1mg/mL
Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 50mM NaCl
Protein
0.5mg
ECH1, 34-328aa. Sequence: MGSSHHHHHHSSGLVPRGSHMTGSSAQEAASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL
RUO
Unlabeled
ELISA, SDS-Page
34.4kDa
>90%
Human
Store at -80°C. Avoid freeze-thaw cycles.
ECH1
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit