Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

436 – 450 of 119,908 results

436

Invitrogen™ Human AXL, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
pH Range	7
Form	Liquid
Molecular Weight (g/mol)	48.3 kDa
Common Name	AXL
Gene Symbol	AXL
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Sequence	473-end
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human AXL, His Tag
Accession Number	P30530
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	Adhesion-related kinase; AI323647; ARK; AXL; AXL oncogene; AXL receptor tyrosine kinase; AXL transforming sequence/gene; AZF1; JTK11; oncogene AXL; sAXL; soluble AXL; Tyro7; Tyrosine-protein kinase receptor UFO; Ufo; ufo oncogene homolog
Product Type	Protein
Gene ID (Entrez)	558
Formulation	50mM sodium phosphate with 0.1mM PMSF, 300mM NaCl, 25% glycerol, 150mM Imidazole, 0.2mM DTT and no preservative; pH 7
Protein Tag	His-tag
Recombinant	Recombinant

437

Invitrogen™ Human CDK7/Cyclin H/MNAT1, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	70% by SDS-PAGE
Conjugate	Unconjugated
Form	Liquid
Common Name	CDK7
Molecular Weight (g/mol)	43.2-42.6-40.5 kDa
Sequence	Full length
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human CDK7/Cyclin H/MNAT1, His Tag
Accession Number	P50613
Gene ID (Entrez)	1022
Protein Tag	His-tag
Species	Human
Recombinant	Recombinant

438

Invitrogen™ Human FYN, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	Fyn
Molecular Weight (g/mol)	62.7 kDa
Sequence	Full length
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human FYN, His Tag
Accession Number	P06241
Regulatory Status	For research use only. Not for use in diagnostic procedures
Gene Alias	AI448320; AW552119; C syn protooncogene; c-syn protooncogene; EC 2.7.10.2; Fyn; fyn {ECO:0000312; FYN oncogene related to SRC, FGR, YES; Fyn proto-oncogene; FYN proto-oncogene, Src family tyrosine kinase; kinase Fyn; MGC45350; OKT3-induced calcium influx regulator; OTTHUMP00000017916; OTTHUMP00000017917; P59 p59-Fyn; p59-Fyn; Proto-oncogene c-Fyn; Protooncogene Syn; proto-oncogene Syn; proto-oncogene tyrosine-protein kinase Fyn; RGD:2641}; RP1-66H14.1; SLK; Src Kinase p59; Src like kinase; src/yes-related novel; src-like kinase; SYN; tyrosine kinase p59fyn(T); tyrosine-protein kinase Fyn
Product Type	FYN Recombinant Human Protein
Gene ID (Entrez)	2534
Formulation	20 mM tris with 0.05% NP-40, 0.05 mM EDTA, 100 mM NaCl, 1 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag	His-tag
Species	Human
Recombinant	Recombinant

439

Invitrogen™ Human PRKCG (PKC gamma), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Shipping Condition	Dry Ice
Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
pH Range	8
Common Name	PKC gamma
Molecular Weight (g/mol)	112.3 kDa
KinaseFamily	PKC Kinase Family
Gene Symbol	PRKCG
Sequence	Full length
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human PRKCG (PKC gamma), GST Tag
Accession Number	P05129
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	PKC; Pkcc; PKCG; PKCgamma; PKC-gamma; PKCI; Prkc; Prkcc; PRKCG; protein kinase C gamma; protein kinase C gamma type; protein kinase C type I (gamma type); protein kinase C, gamma; RATPKCI; SCA14
Product Type	Protein
Gene ID (Entrez)	5582
Formulation	50mM tris HCl with 20% glycerol, 100mM NaCl, 15mM glutathione, 5mM DTT and no preservative; pH 8
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

440

Invitrogen™ Human ERN1, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	IRE1 alpha
Molecular Weight (g/mol)	84.1 kDa
KinaseFamily	IRE Family
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human ERN1, GST Tag
Purification Method	Purified
Gene Alias	9030414B18Rik; AI225830; C85377; endoplasmic reticulum (ER) to nucleus signalling 1; endoplasmic reticulum to nucleus signaling 1; endoplasmic reticulum to nucleus signalling 1; endoplasmic reticulum-to-nucleus signaling 1; Endoribonuclease; ER to nucleus signalling 1; ERN1; FLJ30999; hIRE1p; inositol-requiring 1; inositol-requiring 1 alpha; inositol-requiring enzyme 1; inositol-requiring protein 1; IRE1; IRE1a; IRE1a antibody; Ire1alpha; Ire1-alpha; Ire1p; IRE1p antibody; MGC163277; MGC163279; protein kinase/endoribonuclease; RGD1559716; Serine/threonine-protein kinase; Serine/threonine-protein kinase/endoribonuclease IRE1; serine/threonine-protein kinase/endoribonuclease IRE1-like
Protein Form	Recombinant, Active, Catalytic
Formulation	50mM tris HCl with 25% glycerol, 10mM glutathione, 150mM NaCl, 0.1mM PMSF, 0.25mM DTT, 0.1mM EDTA and no preservative; pH 7.5
Species	Human
Recombinant	Recombinant
Shipping Condition	Dry Ice
Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Gene Symbol	ERN1
Sequence	468-end
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Accession Number	O75460
Regulatory Status	RUO
Product Type	Protein
Protein Length	468-end
Gene ID (Entrez)	2081
Protein Tag	GST-tag

441

Invitrogen™ Human MET (cMET), His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Shipping Condition	Dry Ice
Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	c-Met
Molecular Weight (g/mol)	53.7 kDa
KinaseFamily	MET (HGFR) Kinase Family
Gene Symbol	MET
Kinase Group	Tyrosine Kinases
Sequence	956-1390
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human MET (cMET), His Tag
Accession Number	P08581
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	AI838057; AUTS9; bHLHe59; CG1705; CG1705-PA; CG1705-PB; cmet; c-met; c-met proto-oncogene; c-Met receptor tyrosine kinase; c-Met/HGF receptor; D249; DFNB97; Dmel\CG1705; Dmel_CG1705; DmMet; EC 2.7.10.1; Hepatocyte growth factor receptor; HGF; HGF receptor; HGF receptor c-Met; HGF/SF receptor; HGFR; HGF-SF receptor; juvenile hormone resistance; met; met proto-oncogene; met proto-oncogene (hepatocyte growth factor receptor); met proto-oncogene tyrosine kinase; MET proto-oncogene, receptor tyrosine kinase; Met/Met1; Met; protein tyrosin kinase; methoprene tolerant; Methoprene-tolerant; Methoprene-tolerant protein; Met-PA; Met-PB; Mett; oncogene MET; Par4; Proto-oncogene c-Met; RCCP2; resistance (1) juvenile H; resistance to juvenile hormone; Rst(1)JH; sc MET; scatter factor receptor; SF receptor; soluble c met; tyrosine-protein kinase Met
Product Type	Protein
Gene ID (Entrez)	4233
Formulation	20mM tris with 0.5mM EDTA, 100mM NaCl, 2mM DTT, 50% glycerol, 0.05% Triton X-100 and no preservative; pH 7.5
Protein Tag	His-tag
Species	Human
Recombinant	Recombinant

442

Invitrogen™ Human BRAF, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	B-Raf
Molecular Weight (g/mol)	113.6 kDa
KinaseFamily	RAF Kinase Family
Sequence	Full length
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human BRAF, GST Tag
Accession Number	P15056
Regulatory Status	RUO - research use only
Gene Alias	94 kDa B-raf protein; 9930012E13Rik; AA120551; AA387315; AA473386; Braf; B-raf; B-raf protein; B-raf protein isoform 1; B-raf protein isoform 2; B-Raf proto-oncogene serine/threonine-protein kinase; B-Raf proto-oncogene serine/threonine-protein kinase (p94); B-Raf proto-oncogene, serine/threonine kinase; Braf transforming gene; BRAF1; B-RAF1; Braf2; Braf-2; C230098H17; C87398; C-RMIL; D6Ertd631e; FLJ95109; MGC126806; murine sarcoma viral (v-raf) oncogene homolog B1; NS7; p94; Proto-oncogene B-Raf; proto-oncogene c-Rmil; RAFB1; RMIL; rmil serine/threonine-protein kinase; serine/threonine kinase; serine/threonine-protein kinase B-raf; Serine/threonine-protein kinase Rmil; v-raf murine sarcoma viral oncogene homolog B; v-raf murine sarcoma viral oncogene homolog B1
Gene ID (Entrez)	673
Formulation	50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

443

Invitrogen™ Human Asporin (aa 165-287) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
pH Range	7.4
Form	Liquid
Common Name	Asporin
Gene Symbol	Aspn
Storage Requirements	-20°C, Avoid Freeze/Thaw Cycles
Sequence	IPLNLPKSLAELRIHENKVKKIQKDTFKGMNALHVLEMSANPLDNNGIEPGAFEGVTVFHIRIAEAKLTSVPKGLPPTLLELHLDYNKISTVELEDFKRYKELQRLGLGNNKITDIENGSLAN
Concentration	2.8 mg/mL
Expression System	E. coli
For Use With (Application)	Neutralization,Control
Name	Human Asporin (aa 165-287) Control Fragment
Accession Number	Q9BXN1
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	4631401G09Rik; AA986886; ASPN; Asporin; asporin (LRR class 1); asporin proteoglycan; FLJ20129; OS3; periodontal ligament associated protein 1; periodontal ligament-associated protein 1; PLAP1; PLAP-1; SLRR1C; small leucine-rich protein 1C; UNQ215/PRO241
Product Type	Protein
Gene ID (Entrez)	54829
Formulation	PBS, 1M urea with no preservative; pH 7.4
Protein Tag	His-ABP-tag
Recombinant	Recombinant

444

Invitrogen™ Human CTLA-4 His-tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Protein Family	CD Proteins
Form	Lyophilized
Endotoxin Level	< 1 EU/μg
Gene Symbol	CTLA4
Research Category	Immunology, Virology
Species	Human
Protein	Cytotoxic T-lymphocyte-associated protein 4
Protein Subtype	Other Proteins

445

Invitrogen™ Human AMPK A2/B1/G1, GST Tag, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Shipping Condition	Dry Ice
Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	AMPK alpha-2/beta-1/gamma-1
Molecular Weight (g/mol)	91.4-57.8-41.7 kDa
KinaseFamily	CAMKL Kinase Family
Gene Symbol	PRKAA2, PRKAB1, PRKAG1
Sequence	Full length
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human AMPK A2/B1/G1, GST Tag, His Tag
Accession Number	P54619, P54646, Q9Y478
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	AMPK alpha 2/beta 1/gamma 1; AMPK alpha2/beta1/gamma1
Product Type	Protein
Gene ID (Entrez)	5563, 5564, 5571
Formulation	50mM tris with 2mM DTT, 50% glycerol, 0.5mM EDTA, 150mM NaCl, 0.02% Triton X-100 and no preservative; pH 7.5
Protein Tag	GST-tag, His-tag
Species	Human
Recombinant	Recombinant

446

Invitrogen™ Human DCAMKL2 (DCK2), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	For research use only. Not for use in diagnostic procedures
Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	103.6 kDa
Formulation	50 mM tris HCl with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Sequence	Full length
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human DCAMKL2 (DCK2), GST Tag
Recombinant	Recombinant

447

Invitrogen™ Human FGFR2, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	FGFR2
Molecular Weight (g/mol)	52.1 kDa
KinaseFamily	FGF Receptor Kinase Family
Kinase Group	Tyrosine Kinases
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human FGFR2, His Tag
Purification Method	Purified
Gene Alias	AU043015; AW556123; bacteria-expressed kinase; BBDS; BEK; BEK fibroblast growth factor receptor; BFR-1; CD332; CEK3; CFD1; ECT1; FGF Receptor; FGF Receptor 2; FGF-10; FGFR; FGFR2; FGFR-2; Fgfr7; Fgfr-7; fibroblast growth factor receptor 2; JWS; Keratinocyte growth factor receptor; KGFR; KGFRTr; KSAM; K-SAM; protein tyrosine kinase, receptor like 14; Soluble KGFR; svs; TK14; TK25
Protein Form	Recombinant, Catalytic Domain, Cytoplasmic
Formulation	50mM tris with 150mM NaCl, 50% glycerol, 0.5mM EDTA, 0.04% Triton X-100, 4mM DTT and no preservative; pH 7.5
Species	Human
Recombinant	Recombinant
Shipping Condition	Dry Ice
Gene Symbol	FGFR2
Sequence	403-822
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Accession Number	P21802
Regulatory Status	RUO
Product Type	Protein
Gene ID (Entrez)	2263
Protein Tag	His-tag

448

Invitrogen™ Human MAP4K1 (HPK1), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Protein Family	Kinases & Inhibitors
Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	HPK1
Molecular Weight (g/mol)	65 kDa
Kinase Group	Serine/Threonine Kinase
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human MAP4K1 (HPK1), GST Tag
Purification Method	Purified
Gene Alias	EC 2.7.11.1; Hematopoietic progenitor kinase; hematopoietic progenitor kinase 1; HPK; HPK1; MAP4K1; MAPK/ERK kinase kinase kinase 1; MEK kinase kinase 1; MEKKK 1; mHPK1; mitogen activated protein kinase kinase kinase kinase 1; mitogen-activated protein kinase kinase kinase kinase 1
Protein Form	Recombinant, Full Length
Formulation	50mM tris HCl with 0.25mM DTT, 0.1mM EDTA, 10mM glutathione, 0.1mM PMSF, 25% glycerol, 150mM NaCl and no preservative; pH 7.5
Species	Human
Recombinant	Recombinant
Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Gene Symbol	MAP4K1
Sequence	1-346
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Accession Number	Q92918
Regulatory Status	RUO
Product Type	Protein
Protein Length	1-346
Gene ID (Entrez)	11184
Protein Tag	GST-tag

449

Invitrogen™ Lycopersicon Esculentum (Tomato) Lectin (LEL, TL), Texas Red

Bright-red LEL-fluorophore conjugat

Pricing & Availability

450

Invitrogen™ Human MLCK (MLCK2), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Protein Family	Kinases & Inhibitors
Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	MLCK
Molecular Weight (g/mol)	113.6 kDa
KinaseFamily	MLCK Kinase Family
Kinase Group	Ser⁄Thr Kinases: CAMK Group
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human MLCK (MLCK2), GST Tag
Purification Method	Purified
Gene Alias	caMLCK; cardiac MLCK; cardiac-MLCK; cardiac-MyBP-C associated Ca/CaM kinase; cardiac-MyBP-C-associated Ca/CaM kinase; cardiac-specific myosin light chain kinase; D830007F02Rik; MLC kinase; MLCK; MLCK2; Mylk3; Myosin light chain kinase 3; putative myosin light chain kinase 3; putative myosin light chain kinase 3; myosin light chain kinase 3; RGD1305801
Protein Form	Recombinant, Full Length
Formulation	50mM tris with 0.5mM EDTA, 2mM DTT, 50% glycerol, 150mM NaCl, 0.02% Triton X-100 and no preservative; pH 7.5
Recombinant	Recombinant
Shipping Condition	Dry Ice
Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Gene Symbol	MYLK3
Sequence	Full length
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Protein Subtype	Serine/Threonine Kinases
Accession Number	Q32MK0
Regulatory Status	RUO
Product Type	Protein
Gene ID (Entrez)	91807
Protein Tag	GST-tag

Prev
1
...
28
29
30
31
...
7,994
Next

Recombinant Proteins

Filtered Search Results

Narrow Results