Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
For Use With (Application)
- (2)
- (2,391)
- (1)
- (23,537)
- (5)
- (1)
- (1)
- (68)
- (547)
- (9,349)
- (23)
- (1)
- (7)
- (2)
- (13)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (70)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (157)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (253)
- (26,478)
- (1)
- (1)
- (2)
- (1)
- (25)
- (36,443)
- (1,335)
- (2)
- (2)
- (32)
- (3)
- (787)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (123)
- (1)
- (144)
- (1,405)
- (3)
- (4)
- (7)
- (5)
- (1)
- (3)
- (1)
- (1)
- (1)
- (14)
- (11,447)
- (48)
- (6)
- (31)
- (16)
- (1)
- (10)
- (4)
- (110)
- (18)
- (2)
- (3)
- (119)
- (4)
- (148)
- (98)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,578)
- (2)
- (1)
- (160)
- (48)
- (11)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (21,952)
- (2,939)
- (4)
- (1)
- (2)
- (114)
- (2,860)
- (4)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (34,931)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (6)
- (1)
- (1)
- (8,296)
- (6)
- (4)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (14)
- (19)
- (1)
- (3)
- (3)
- (4)
- (36,975)
- (1,823)
- (1)
- (3)
Recombinant
- (285)
- (9)
- (66,416)
- (1)
Form
- (15)
- (1)
- (2)
- (45,198)
- (10,339)
- (245)
- (168)
- (56)
- (3,358)
Species
- (2)
- (1)
- (2)
- (1)
- (90)
- (557)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (5)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,302)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (29,100)
- (5)
- (22)
- (8)
- (4)
- (1,290)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (8)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (233)
- (9)
- (2)
- (5)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,572)
- (1)
- (44)
Regulatory Status
- (79)
- (54,649)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
5,626
–
5,640
of
129,857
results
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Purity or Quality Grade | >95% as determined by SDS-PAGE. |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Common Name | ANGPTL2 |
| Molecular Weight (g/mol) | 58 kDa |
| Gene Symbol | ANGPTL2 |
| Endotoxin Concentration | <1.0 EU/μg |
| Sequence | Mouse ANGPTL2, amino acids Asp245-His493 (Accession # Q9R045) with an N-terminal human IgG1 Fc region |
| Expression System | HEK293 cells |
| For Use With (Application) | Control,Neutralization |
| Name | Mouse ANGPTL2 Fc Chimera |
| Accession Number | Q9R045 |
| Purification Method | Purified |
| Gene Alias | AI593246; angiopoietin like 2; angiopoietin related protein 2; angiopoietin-like 2; angiopoietin-like protein 2; Angiopoietin-related protein 2; angiopoietin-related protein-2; Angptl2; ARP2; AW260363; HARP; MGC8889; UNQ170/PRO196 |
| Format | Lyophilized |
| Product Type | Protein |
| Gene ID (Entrez) | 26360 |
| Formulation | PBS with 0.01% mannitol, 5-8% trehalose, 0.01% Tween 80 and no preservative; pH 7.4 |
| Protein Tag | Fc-tag |
| Recombinant | Recombinant |
Invitrogen™ Human SNX22 (aa 82-189) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ Human PPP4C (aa 1-53) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
R&D Systems™ Recombinant Human LRPAP Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Binding Activity
Invitrogen™ Human C1orf110 (aa 10-92) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
R&D Systems™ Recombinant Cynomolgus LIFR alpha Fc Chimera Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Carrier Free Recombinant Protein
Invitrogen™ Human CD24 Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Novus Biologicals™ CCS/SOD4 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | CCS/SOD4 |
| Molecular Weight (g/mol) | 31.2kDa |
| Gene ID (Entrez) | 9973 |
| Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl 1mM DTT, 10% glycerol |
| Immunogen | CCS, 1-274 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIRSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
Novus Biologicals™ HDHD2 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | HDHD2 |
| Molecular Weight (g/mol) | 30.6kDa |
| Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol, 0.1M NaCl |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | SDS-PAGE |
Invitrogen™ Human TTC12 (aa 27-104) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
R&D Systems™ Recombinant Human CHST15 Protein, CF
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity
Invitrogen™ Human SDF2 (aa 134-164) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More